Previous Article | Next Article 
Molecular and Cellular Biology, November 1998, p. 6245-6252, Vol. 18, No. 11
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
Synergistic Regulation of Schwann Cell
Proliferation by Heregulin and Forskolin
Mohammed
Rahmatullah,
Allen
Schroering,
Katrina
Rothblum,
Richard C.
Stahl,
Bobbi
Urban, and
David J.
Carey*
Henry Hood Research Program, Weis Center for
Research, Penn State College of Medicine, Danville, Pennsylvania
17822-2613
Received 6 May 1998/Returned for modification 18 June 1998/Accepted 3 August 1998
 |
ABSTRACT |
A peptide corresponding to the epidermal growth factor homology
domain of
-heregulin stimulated autophosphorylation of the heregulin
receptors erbB2 and erbB3 in Schwann cells and activation of the
mitogen-activated protein (MAP) kinases ERK1 and ERK2. Heregulin-dependent activation of PAK65, a component of the
stress-activated signaling pathway, ribosomal S6 kinase, and a cyclic
AMP (cAMP) response element binding protein (CREB) kinase, identified
as p95RSK2, was also observed. Receptor
phosphorylation and activation of these kinases in response to
heregulin occurred in the absence of forskolin stimulation and were not
augmented in cells treated with forskolin, a direct activator of
adenylyl cyclase. Schwann cell proliferation in response to heregulin
was observed only when the cells were also exposed to an agent that
elevates cAMP levels. In the absence of heregulin, elevation of cAMP
levels failed to stimulate Schwann cell proliferation. Forskolin
significantly enhanced heregulin-stimulated expression of cyclin D and
phosphorylation of the retinoblastoma gene product. In cells treated
with both heregulin and forskolin there was a sustained accumulation of phospho-CREB, which was not observed in cells treated with either agent
alone. Heregulin and forskolin synergistically activated transcription
of a cyclin D promoter construct. These results demonstrate that
heregulin-stimulated activation of MAP kinase is not sufficient to
induce maximal Schwann cell proliferation. Expression of critical cell
cycle regulatory proteins and cell division require activation of both
heregulin and cAMP-dependent processes.
 |
INTRODUCTION |
Myelination of axons by Schwann
cells is critical for the proper functioning of the peripheral nervous
system. The correct ratio of Schwann cells to axons is achieved during
development through a combination of Schwann cell proliferation
(26) and programmed cell death (29). Studies with
primary cultures of Schwann cells and embryonic sensory neurons have
shown that molecular signals that stimulate Schwann cell proliferation
are associated with axonal membranes (24, 27, 35).
Several lines of evidence suggest that the axonal Schwann cell mitogen
is a member of the heregulin family of growth factors (5, 9, 17,
21). A common structural feature of heregulins is a cysteine-rich
domain of approximately 50 amino acids that is homologous to the active
domain of epidermal growth factor (EGF) (18). Heregulins
stimulate cell proliferation by binding to and activating transmembrane
receptor tyrosine kinases with homology to the EGF receptor, called
erbB2, erbB3, and erbB4 (10, 25). A synthetic peptide
corresponding to the heregulin EGF homology domain is sufficient to
mediate binding to erbB receptors (2). Ligand-dependent
activation of erbB receptors leads to activation of the
mitogen-activated protein (MAP) kinase pathway, which is critical for
cell division in many cell types (22).
Schwann cell proliferation can also be stimulated by other polypeptide
growth factors (6), including basic fibroblast growth factor
and platelet-derived growth factor (PDGF). An unusual feature of the
response of Schwann cells to these mitogens is the additional requirement for an agent that raises intracellular cyclic AMP (cAMP)
levels in order to produce cell division (5, 6, 12, 23).
This is in contrast to most cell types, whose proliferation is
inhibited by cAMP (3, 13, 31). cAMP has been reported to be
required for expression of PDGF and insulin-like growth factor
receptors in Schwann cells (34).
One of the exceptions to the inhibitory effect of cAMP on cell division
occurs in dog thyroid cells (14, 16). Elevation of cAMP
levels in these cells by treatment with thyroid-stimulating hormone or
forskolin induces cell proliferation. This effect occurs in the absence
of other mitogens or growth factors. Interestingly, cAMP-stimulated
proliferation of these cells does not require activation of the MAP
kinase pathway (14) but is dependent on expression of the
cell cycle regulatory protein cyclin D (16).
cAMP-dependent regulation is mediated through protein kinase A (PKA).
cAMP binds to the regulatory subunit of PKA, causing release of the
active catalytic subunit and phosphorylation of target proteins. One of
the targets of PKA-mediated phosphorylation is the cAMP response
element binding protein, or CREB (19). CREB is a DNA-binding
protein that binds to cAMP response elements in the promoters of target
genes and, in its phosphorylated form, activates their transcription.
CREB kinase activities are also induced by some growth factors, such as
insulin and nerve growth factor, via the ras-MAP kinase pathway
(7, 36).
In this paper data are presented which demonstrate that
-heregulin
stimulates phosphorylation of erbB2 and erbB3 in Schwann cells,
activation of the MAP kinase pathway, and transient phosphorylation of
CREB. Heregulin-dependent activation of these processes is not
sufficient, however, to elicit expression of cyclin D or to stimulate
Schwann cell proliferation. Schwann cell proliferation is shown to
require long-term costimulation with both heregulin and an activator of
adenylyl cyclase.
 |
MATERIALS AND METHODS |
Materials.
Monoclonal antibodies that recognize the
phosphorylated forms of MEK1 and MEK2 were obtained from New England
Biolabs, Inc. Rabbit polyclonal antibodies against CREB and
phospho-CREB and mouse monoclonal antibodies against erbB2, erbB4, and
p95RSK2 were from Upstate Biotechnology, Inc.
Monoclonal anti-cyclin D, anti-ribosomal S6 kinase, and polyclonal
anti-erbB3 antibodies were from Santa Cruz Laboratories.
Anti-phospo-MAP kinase antibodies were from New England Biolabs.
[
-32P]ATP (3,000 Ci/mmol) was purchased from
Dupont-NEN. [methyl-3H]thymidine (76 Ci/mmol)
was purchased from Amersham Life Sciences. Myelin basic protein was
obtained from GIBCO-BRL. CREBtide, a peptide containing the
phosphorylation site of CREB (KRREILSRRPSYRK), and a peptide
corresponding to the EGF homology domain of
-heregulins (SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVM) were
synthesized in the Weis Center for Research Molecular Biology Core
Laboratory. The latter peptide was purified as described previously
(2). Forskolin, insulin, and transferrin were from Sigma
Chemical Co. Other culture media components were from GIBCO-BRL.
Cell culture.
Schwann cells were isolated from the sciatic
nerves of newborn rats as described previously (4). For
routine culture the cells were grown on
poly-L-lysine-coated tissue culture dishes in Dulbecco's
modified Eagle's medium (DME) containing 10% fetal bovine serum and 2 µM forskolin. The cultures contained >95% Schwann cells as
indicated by staining with cell-specific antibodies. For the
experiments described in this paper, the cells were used between
passage 2 and passage 5.
Cell proliferation assays.
Confluent cultures of Schwann
cells, cultured as described above, were trypsinized and replated in
poly-L-lysine-coated 96-well plates at a density of 50,000 cells/cm2. The cells were allowed to attach overnight in
DME-10% fetal bovine serum containing 2 µM forskolin. The next day
the medium was switched to serum-free medium (DME-Ham's F-12, 1:1,
supplemented with 0.1 mg of transferrin and 0.1 µg of insulin per ml)
containing mitogens and forskolin as indicated in Results. After 6 days
the cell numbers were determined by the CellTiter 96 AQueous assay (Promega). The absorbance at 490 nm was measured with a Spectramax 250 microplate spectrophotometer.
In some experiments cell proliferation was assayed by measuring the
incorporation of 3H-thymidine. The cells were plated at a
density of 50,000 cells/cm2 in
poly-L-lysine-coated 24-well plates and incubated overnight in DME-10% fetal bovine serum. The cells were then incubated in serum-free medium without mitogens or forskolin for 24 h. The cells were switched to serum-free medium without or with heregulin and/or forskolin, as indicated in Results. The medium was supplemented with 1 µCi of [3H]thymidine per ml. The cells were
lysed at various times after mitogen stimulation (48 h in most
experiments). Aliquots were precipitated with trichloroacetic acid. The
precipitates were collected on glass fiber filters and counted in a
liquid scintillation counter.
Receptor phosphorylation assays.
Schwann cells were
trypsinized and replated at a density of 50,000 cells/cm2
in poly-L-lysine-coated culture plates (60-mm diameter) and
allowed to attach overnight in DME-10% fetal bovine serum. The cells
were incubated for 24 h in serum-free medium without or with
forskolin. Fresh medium containing heregulin and/or forskolin was
added, and the cells were incubated at 37°C for various times (see
Results). The cells were lysed in immunoprecipitation buffer (0.5%
Nonidet P-40; 0.5% deoxycholate; 0.1% sodium dodecyl sulfate [SDS];
50 mM Tris-HCl, pH 7.5). Aliquots were immunoprecipitated with
anti-erbB2, anti-erbB3, or anti-erbB4 antibodies. Immune complexes were
precipitated by addition of protein A-Sepharose beads coated with
anti-rabbit immunoglobulin G. The proteins were resolved by SDS-gel
electrophoresis, transferred to Immobilon membranes, blocked in 5%
nonfat milk in 50 mM Tris-HCl (pH 7.5) and 100 mM NaCl, and stained
with antiphosphotyrosine antibodies. Bound antibodies were detected by
enhanced chemiluminescence.
Kinase assays.
Schwann cells were trypsinized and replated
in poly-L-lysine-coated six-well plates (35-mm diameter per
well) and were allowed to attach overnight in DME-10% fetal bovine
serum. The cells were then incubated in serum-free medium with various
concentrations of forskolin for 24 h. The cells were stimulated
with heregulin peptide for various times in the absence or presence of
forskolin, as indicated in Results. The cells were rinsed quickly with
cold phosphate-buffered saline and then lysed in 100 µl of kinase
lysis buffer (20 mM Tris-HCl, pH 7.5; 1% Triton X-100; 20 mM NaF; 2 mM
EDTA; 0.1 mM Na orthovanadate; 1 mM dithiothreitol [DTT]; 2 mM
4-(2-aminoethyl)benzene sulfonyl flouride (AEBSF); 10 mM benzamidine; and 1 µg each of aprotinin and leupeptin per ml) per well. The cells
were scraped into Microfuge tubes, lysed by free thawing, and shaken on
a rotator for 10 min at 4°C. Protein levels were determined with the
Bio-Rad assay kit.
MAP kinase activity was measured by a modification of the in-gel method
described previously (
11). Equal amounts of protein
from
cell extracts were separated on SDS-10% polyacrylamide gels
that
contained 0.1 mg of myelin basic protein per ml. After electrophoresis
the gels were incubated sequentially in 50 mM Tris-HCl (pH 8),
20%
isopropanol (twice for 30 min each), 50 mM Tris-HCl (pH 8),
5 mM
2-mercaptoethanol (once for 60 min), 50 mM Tris-HCl (pH 8),
and 6 M
guanidine (twice for 30 min each). Proteins in the gel
were renatured
by incubation for 16 h at 4°C in 50 mM Tris-HCl
(pH 8)-0.04%
Tween 20. The gels were then incubated for 1 h at
room temperature
in 40 mM Na HEPES (pH 8), 2 mM DTT, and 10 mM
MgCl
2. Kinase
assays were carried out for 1.5 h at 37°C in a mixture
of 40 mM
Na HEPES (pH 8), 2 mM DTT, 10 mM MgCl
2, and 0.5 mM EGTA
containing 10 µCi of [

-
32P]ATP (0.1 mM) per ml.
Reactions were terminated by placing the
gels in 5% trichloroacetic
acid and 1% sodium pyrophosphate. The
gels were washed several times
in this solution to remove unreacted
radioactivity. The gels were dried
and exposed on Kodak X-Omat
film with an intensifying screen.
Radioactivity was quantitated
by PhosphorImager analysis (Molecular
Dynamics). In-gel PAK65
(
30) and CREB kinase (
7)
assays were performed in a similar
manner, except that the gels
contained 0.2 mg of histone H1 or
0.2 mg of CREBtide per ml as the
substrate. For CREB kinase assays
the reaction buffer was 50 mM PIPES
[piperazine-
N,
N'-bis(2-ethanesulfonic
acid)],
(pH 7.2), 10 mM MgCl
2, 2 mM DTT, and 20 µCi of
[

-
32P]ATP (0.1 mM).
MAP kinase activation was also assayed by immunoblot analysis of
aliquots of cell lysates with antibodies that specifically
recognize
the phosphorylated forms of ERK1 and ERK2.
Cyclin D3 promoter-reporter vector construction and
transfection.
An 835-bp DNA segment immediately upstream of the
rat cyclin D3 transcription start site was obtained by PCR
amplification with specific primers based on the published gene
sequence (37) and rat genomic DNA (Clontech). The amplified
product was cloned into plasmid pCR3.1 (Clontech). The DNA sequence of
the insert (data not shown) was identical to the rat cyclin D3 5'
flanking sequence reported previously (37). The insert was
excised by digestion with XhoI and NheI and
subcloned into the multiple cloning site of the plasmid pGL3-basic
(Promega), immediately upstream of the luciferase coding region.
Correct insertion of the cyclin D3 promoter sequence was verified by
DNA sequence analysis.
Promoter activity was determined in transiently transfected Schwann
cells. The cells were plated in 24-well culture dishes
and transfected
with 0.2 µg of cyclin D reporter plasmid for 3
h by using
Lipofectamine-Plus in serum-free OptiMEM (Life Technologies,
Inc.).
Following transfection the cells were allowed to recover
overnight in
DME-10% fetal bovine serum. The cells were then incubated
for 24 h in serum-free medium. During this period the medium was
changed three
times. This was necessary to remove residual serum
components and to
decrease the basal cyclin D reporter activity.
The cells were then
stimulated with heregulin and/or forskolin
as described in Results.
Forty-eight hours later the cells were
lysed. Aliquots were used for
assays of luciferase activity with
the Promega assay kit and an EG & G
Berthold luminometer.
 |
RESULTS |
Mitogenic activity of
-heregulin requires elevation of
cAMP.
Stimulation of Schwann cell proliferation with purified
mitogens, such as basic fibroblast growth factor or PDGF, requires costimulation with an agent that results in elevation of cAMP levels
(6, 23). Experiments were carried out to determine whether
elevation of cAMP levels was required for heregulin-dependent mitogenic
activity. Schwann cells were cultured in the absence or presence of a
synthetic peptide corresponding to the EGF homology domain of
-heregulin (2). As shown in Fig.
1A, heregulin peptide failed to produce a
significant increase in the number of cells present after 6 days,
compared with cultures incubated in serum-free medium without growth
factor. In contrast, treatment of Schwann cells with heregulin in the
presence of forskolin, a direct activator of adenylyl cyclase, produced
a significant increase in cell numbers. Forskolin at concentrations of
0.2 µM and 2 µM produced similar responses. In the absence of
heregulin, forskolin had no effect on cell numbers. The requirement for
forskolin could not be overcome by increasing the heregulin
concentration (Fig. 1B). The effects of heregulin on cell numbers were
not due to increased survival. The cell numbers determined after 6 days
represented an increase over the numbers that had been plated
initially. Moreover, under the conditions used in this assay, no
significant loss of Schwann cells was observed in the absence of
exogenous growth factors (data not shown).

View larger version (31K):
[in this window]
[in a new window]
|
FIG. 1.
Effect of forskolin on heregulin-dependent Schwann cell
proliferation. (A) Schwann cells were incubated for 6 days in
serum-free medium or DME-10% fetal calf serum (FCS) in the absence
(none) or presence of 250 ng of heregulin peptide ( -her) per ml,
without forskolin (hatched bars) or with 0.2 µM (open bars) or 2 µM
(solid bars) forskolin. The values shown are the means ± standard
errors of the mean for eight wells. This experiment was carried out
three times with similar results. (B) Schwann cells were incubated for
6 days in serum-free medium without (open circles) or with (filled
circles) 2 µM forskolin and the indicated concentration of heregulin
peptide. Values shown are means ± standard errors of the mean for
eight wells. (C) Schwann cells were made quiescent by incubation for
24 h in serum-free medium and then were switched to serum-free
medium containing 250 ng of heregulin peptide per ml and the indicated
concentrations of forskolin plus [3H]thymidine. The cells
were incubated for 48 h and incorporation of
[3H]thymidine was determined as described in Materials
and Methods. Values shown are means ± standard errors of the mean
for eight wells. (D) Schwann cells were treated as described for C,
except that serum-free medium without (hatched bars) or with (solid
bars) heregulin was supplemented with 2 µM forskolin (Fsk), cholera
toxin (CT), or 8-Br-cAMP (cAMP).
|
|
Fetal bovine serum in the absence of other mitogens also stimulated
Schwann cell proliferation, although to a lesser degree
than heregulin.
Interestingly, the mitogenic activity of serum
was not dependent on
forskolin. Addition of heregulin to medium
containing 10% fetal bovine
serum produced an increase in cell
numbers that was greater than that
produced by either agent alone.
Similar to what was observed in
serum-free medium, the heregulin-dependent
stimulation of proliferation
in the presence of serum required
forskolin.
A similar effect of forskolin on heregulin-dependent mitogenic activity
was observed when cell proliferation was assayed by
[
3H]thymidine incorporation. Addition of forskolin to
serum-free
medium containing heregulin increased
[
3H]thymidine incorporation nearly 40-fold over what was
measured
in the absence of forskolin (Fig.
1C). In the absence of
heregulin,
forskolin did not stimulate incorporation of
[
3H]thymidine (data not shown). Maximal stimulation of
heregulin-dependent
DNA synthesis was observed at forskolin
concentrations of 0.2
µM or greater (Fig.
1C). Similar stimulation of
heregulin-dependent
[
3H]thymidine incorporation was
observed when cholera toxin or 8-Br-cAMP
was used in place of forskolin
(Fig.
1D). Cholera toxin directly
activates the

subunit of
G
s, the heterotrimeric GTP-binding
protein responsible for
stimulation of adenylyl cyclase. 8-Br-cAMP
is a cell-permeative cAMP
analogue. These results suggest that
effects of forskolin on Schwann
cell proliferation are dependent
on its ability to activate adenylyl
cyclase.
Phosphorylation of erbB receptors and activation of MAP kinase by
heregulin.
Heregulin growth factors stimulate cell proliferation
by binding to and activating erbB receptor kinases (10, 25).
Consistent with previous reports (29, 32), stimulation of
Schwann cells with heregulin resulted in tyrosine phosphorylation of
erbB2 and erbB3 (Fig. 2A).
Phosphorylation of erbB4 was not detected (data not shown).

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 2.
Heregulin-dependent activation of erbB receptors and
signaling kinases in Schwann cells. (A) Schwann cells were incubated
for 48 h in serum-free medium without forskolin ( Fsk) or with 2 µM forskolin (+Fsk). The cells were then stimulated with 250 ng of
heregulin peptide per ml in medium that lacked ( ) or contained (+) 2 µM forskolin. After 15 min the cells were lysed and aliquots of
control and heregulin-stimulated cells were immunoprecipitated with
antibodies to erbB2 or erbB3 and subjected to immunoblot analysis with
antiphosphotyrosine antibodies. (B) Schwann cells were incubated for
24 h in serum-free medium containing the indicated concentrations
of forskolin (Fsk). Heregulin peptide (250 ng/ml) was added and the
cells were lysed at the indicated times after heregulin addition.
Aliquots of the lysates were assayed for MEK activation by immunoblot
analysis with anti-phospho-MEK1,2 antibody (upper panel) and for MAP
kinase (middle panel) and PAK65 (lower panel) activation by in-gel
kinase assays. (C) Schwann cells were treated as described for B. Aliquots of cell lysates were subjected to immunoblot analysis with
anti-p70RSK antibodies.
|
|
To determine whether cAMP affected heregulin receptor expression or
heregulin-dependent receptor activation, Schwann cells
were grown for
48 h in serum-free medium in the absence or presence
of 2 µM
forskolin and then stimulated with heregulin in the absence
or presence
of 2 µM forskolin. As shown in Fig.
2A, phosphorylation
of erbB2 and
erbB3 in response to heregulin was observed in the
absence of
forskolin. Neither long-term nor acute treatment with
forskolin had any
effect on heregulin-stimulated tyrosine phosphorylation
of the
receptors.
Heregulins have been reported to activate MAP kinase in Schwann cells
(
12). Stimulation of Schwann cells with heregulin
peptide
caused a rapid, sustained activation of the MAP kinase
pathway.
Heregulin activated the MAP kinase kinases MEK1 and MEK2
and the 44- and 42-kDa forms of MAP kinase (ERK 1 and ERK2) (Fig.
2B).
PAK65 is a kinase that is a component of the stress-activated signaling
pathway in some cells (
1,
38). As shown in Fig.
2B, PAK65
was also activated in response to heregulin stimulation
of Schwann
cells. Activation of the 70-kDa ribosomal S6 kinase,
p70
RSK (Fig.
2C), and
p95
RSK2 (see below), a downstream target of MAP
kinase (
36), was also
observed in heregulin-treated cells.
Forskolin had no effect on heregulin-dependent activation of MEK, MAP
kinase, PAK65 (Fig.
2B), p70
RSK (Fig.
2C), or
p95
RSK2 (see below). These results demonstrate
that stimulation of proliferation
by forskolin does not result from
induction of heregulin receptor
expression, from changes in
heregulin-dependent receptor activation,
or from coupling to downstream
kinase pathways.
Schwann cell proliferation requires long-term simultaneous exposure
to heregulin and forskolin.
When Schwann cells were incubated for
24 h in serum-free medium without mitogens and then switched to
medium containing heregulin and forskolin, a large increase in DNA
synthesis occurred between 32 and 48 h after initiation of
heregulin-forskolin stimulation (Fig. 3).
These results suggest that incubation in serum-free medium arrests the
Schwann cells in a G0-like state and that progression to S
phase occurs in approximately 32 h. This is consistent with earlier measurements of the time course of DNA synthesis in Schwann cells (12). When the cells were incubated in medium
containing heregulin and forskolin for 24 h and then switched to
medium containing only heregulin or forskolin, entry into S phase did
not occur (Fig. 3). Preincubation of Schwann cells in medium containing forskolin for 24 h, followed by incubation in medium with
heregulin (without forskolin), also failed to stimulate Schwann cell
proliferation (data not shown). These results demonstrate that
long-term simultaneous exposure to forskolin and heregulin is needed to
stimulate Schwann cell division.

View larger version (19K):
[in this window]
[in a new window]
|
FIG. 3.
Schwann cell proliferation requires continuous exposure
to heregulin and forskolin. Schwann cells were replated and incubated
in serum-free medium for 24 h and then switched (at time zero) to
serum-free medium containing 250 ng of heregulin peptide per ml and 2 µM forskolin. After 24 h (arrow) the medium was changed and the
cells were incubated for an additional 48 h in serum-free medium
supplemented with both heregulin and forskolin (complete) heregulin
only ( Fsk), forskolin only ( -her) or neither ( Fsk/ -her).
Incorporation of [3H]thymidine was assayed as described
in Materials and Methods.
|
|
Heregulin-dependent expression of cyclin D is potentiated by
forskolin.
Mitogen-dependent stimulation of cell proliferation
requires expression of the cell cycle regulatory protein cyclin D
(28). Schwann cells were incubated in serum-free medium for
24 h and then stimulated with heregulin in the absence or presence
of forskolin. The accumulation of cyclin D was determined by immunoblot
analysis. As shown in Fig. 4A, heregulin
weakly stimulated cyclin D accumulation in Schwann cells. Incubation in
medium with heregulin and forskolin, however, produced a significantly
higher level of cyclin D accumulation than incubation in medium lacking
forskolin (Fig. 4A). Treatment with forskolin alone failed to induce
cyclin D accumulation (data not shown). In cells treated with heregulin
and forskolin cyclin D was detected after a lag period of several
hours, and it peaked approximately 11 h after initiation of
-heregulin stimulation (Fig. 4A). Cyclin D levels remained elevated
for at least 48 h after stimulation with heregulin and forskolin
(data not shown).

View larger version (38K):
[in this window]
[in a new window]
|
FIG. 4.
Forskolin potentiates heregulin-stimulated expression of
cyclin D and pRb phosphorylation. Schwann cells were incubated for
24 h in serum-free medium and then stimulated with 2 µM
forskolin (Fsk), 250 ng of heregulin peptide per ml, or heregulin plus
2 µM forskolin. At the indicated times (in hours) after addition of
these agents, the cells were lysed. Aliquots were subjected to
immunoblot analysis and stained with antibodies to cyclin D (A) or pRb
(B).
|
|
Cell division in many cells requires phosphorylation of the
retinoblastoma gene product, pRb (
33). Phosphorylation of
pRb
is accomplished by the cyclin-dependent kinases cdk4 and cdk6.
Activity of these kinases is stimulated by association with cyclin
D
(
28). As shown in Fig.
4B, exposure of quiescent Schwann
cells
to forskolin or heregulin failed to elicit pRb phosphorylation,
as determined by the lack of a shift in the electrophoretic mobility
of
the protein. In contrast, treatment of Schwann cells with heregulin
and
forskolin resulted in a distinct reduction in mobility of
pRb.
Steady-state levels of pRb also appeared to be increased
in cells
exposed to both heregulin and forskolin. pRb phosphorylation
in
response to heregulin and forskolin was detected after a lag
period of
18 h and persisted until at least 48 h.
Heregulin- and forskolin-dependent CREB phosphorylation.
The
results presented above suggest that stimulation with both heregulin
and forskolin is required for high-level expression of cyclin D. The
best-characterized mechanism for cAMP-dependent regulation of gene
expression involves the PKA-mediated phosphorylation of CREB
(19). CREB activation was assayed in Schwann cells by immunoblot analysis with an antibody that recognizes CREB that is
phosphorylated at the site (serine 133), shown to be critical for
transcriptional activation. Phospho-CREB was not detected in quiescent
Schwann cells incubated in serum-free medium. Stimulation with 2 µM
forskolin produced a modest increase in phospho-CREB (Fig.
5A). Stimulation of the cells with
heregulin produced a rapid and robust increase in phospho-CREB (Fig.
5A). When assayed at times ranging from 15 to 40 min after stimulation,
heregulin was more effective than forskolin in stimulating CREB
phosphorylation. At these times, forskolin had no apparent effect on
heregulin-dependent CREB phosphorylation.

View larger version (25K):
[in this window]
[in a new window]
|
FIG. 5.
Identification of heregulin-stimulated CREB kinase
activity. (A) Schwann cells were incubated for 24 h in serum-free
medium and then stimulated with 2 µM forskolin (Fsk) and/or 250 ng of
heregulin peptide ( -her) per ml. After 30 min the cells were lysed
and aliquots were subjected to immunoblot analysis with
anti-phospho-CREB antibodies. (B) Schwann cells were incubated for
48 h in serum-free medium without forskolin or with 0.2 µM or 2 µM forskolin. Heregulin peptide (250 ng/ml) was added and the cells
were lysed at the indicated times after heregulin addition. Aliquots of
control and heregulin-stimulated cells were used to assay CREB kinase
activity by means of an in-gel assay. The region of the gel below 45 kDa is not shown. (C) Schwann cells were incubated for 24 h in
serum-free medium and then stimulated with 250 ng of heregulin peptide
per ml. At the indicated times (in minutes) the cells were lysed, and
aliquots were subjected to immunoblot analysis with
anti-p95RSK2 antibodies. The arrows on the right
indicate positions of migration of p95RSK2
before and after (*) stimulation with heregulin. Positions of migration
of molecular mass markers (in kilodaltons) are indicated in all
panels.
|
|
An in-gel kinase assay revealed two CREB kinase activities in Schwann
cells. One of these corresponded to a polypeptide of
42 kDa. The CREB
kinase activity of this protein was blocked by
H-89, a specific PKA
inhibitor (data not shown). These results
identify this kinase as the
catalytic subunit of PKA. The other
CREB kinase activity was associated
with a polypeptide of 95 kDa
(Fig.
5B). CREB kinase activity of this
protein was not observed
in the absence of heregulin but was stimulated
rapidly following
heregulin treatment. Heregulin-dependent stimulation
of the 95-kDa
CREB kinase activity occurred in the absence of
forskolin. Forskolin
alone had no effect on the activity of this kinase
but appeared
to cause an increase in its activity following heregulin
stimulation
of the cells.
p95
RSK2 is a protein that has been shown to
possess CREB kinase activity and to be a substrate for phosphorylation
by MAP kinase
(
36). p95
RSK2 was
identified by immunoblot analysis in Schwann cell extracts.
Moreover,
heregulin stimulation of the cells produced a reduction
in the
electrophoretic mobility of p95
RSK2 (Fig.
5C),
consistent with its modification by phosphorylation.
Taken together,
these results strongly suggest that the heregulin-stimulated
Schwann
cell CREB kinase is p95
RSK2.
The effects of long-term stimulation with heregulin and forskolin on
CREB phosphorylation were also examined. As shown in
Fig.
6B, heregulin-stimulated CREB
phosphorylation was transient
and did not coincide temporally with
heregulin-forskolin-stimulated
expression of cyclin D (Fig.
4A). In
contrast, continuous exposure
to both heregulin and forskolin resulted
in a prolonged phosphorylation
of CREB (Fig.
6C). Under these
conditions there appeared to be
a biphasic response. This sustained
increase in CREB phosphorylation
was not observed in cells treated with
forskolin alone (Fig.
6A).

View larger version (46K):
[in this window]
[in a new window]
|
FIG. 6.
Time course of heregulin- and forskolin-dependent CREB
phosphorylation. Schwann cells were incubated for 24 h in
serum-free medium and then stimulated with 2 µM forskolin (A), 250 ng
of heregulin peptide per ml (B), or forskolin plus heregulin (C). Cells
were lysed at the indicated times (in hours) after stimulation.
Aliquots were subjected to immunoblot analysis with anti-phospho-CREB
antibodies.
|
|
Heregulin and forskolin synergistically promote activation of
cyclin D transcription.
To examine more directly the effects of
heregulin and forskolin on cyclin D expression, a reporter construct
was generated in which transcription of the luciferase gene was
regulated by an 835-bp DNA sequence corresponding to the 5' flanking
region of the rat cyclin D3 gene (37). Schwann cells were
transiently transfected with this reporter vector and then incubated in
serum-free medium alone or in medium supplemented with heregulin,
forskolin, or both agents. Figure 7 shows
the levels of luciferase activity measured in lysates prepared at
48 h after initiation of these treatments. In the absence of
heregulin and forskolin a low level of luciferase activity was present
in the cells. Forskolin treatment failed to increase luciferase
activity and in most experiments produced a slight decrease. Heregulin
treatment increased luciferase activity five- to eightfold (data from
three separate experiments). Incubation in medium with heregulin and
forskolin produced an even greater increase in luciferase activity.
Forskolin increased luciferase activity by an average of 3.7-fold
(±0.9 in four experiments) over the activity present in cells treated
with heregulin alone. These results demonstrate that heregulin and
forskolin synergistically activate transcription of the cyclin D3 gene
in Schwann cells.

View larger version (15K):
[in this window]
[in a new window]
|
FIG. 7.
Synergistic activation of cyclin D3 promoter by
heregulin and forskolin. Schwann cells were transiently transfected
with the rat cyclin D3 reporter vector as described in Materials and
Methods. The cells were made quiescent by incubation in serum-free
medium for 24 h and then switched to medium containing 250 ng of
heregulin per ml and/or 2 µM forskolin. After 48 h the cells
were lysed and aliquots were used to assay luciferase activity. The
values shown are means ± standard deviations of triplicate
values. The graph shows representative data from one of three
independent experiments that produced essentially identical results.
|
|
 |
DISCUSSION |
The results presented in this paper demonstrate that
activation of both heregulin and cAMP-dependent pathways is needed to stimulate proliferation of rat Schwann cells. Activation of
cAMP-dependent pathways appeared to have no effect on heregulin
receptor autophosphorylation or on coupling to proximal downstream
signaling pathways. In spite of this, exposure to both heregulin and
forskolin was needed to achieve sustained, high-level cyclin D
expression and hyperphosphorylation of pRb. Experiments with a
luciferase reporter vector linked to a cyclin D promoter demonstrated
that heregulin and forskolin, a direct activator of adenylyl cyclase,
activated cyclin D transcription in a synergistic fashion. These
findings demonstrate a novel mechanism for cAMP-dependent regulation of
heregulin-stimulated Schwann cell proliferation. This mechanism is
distinct from that demonstrated previously for PDGF. Forskolin has been
reported to be required for expression of PDGF receptors by Schwann
cells (34).
Heregulin activated a number of distinct signaling pathways in Schwann
cells. Heregulin stimulation led to autophosphorylation of erbB2 and
erbB3. At least some of these phosphorylated receptors were present in
heteromeric complexes containing both receptor molecules, as indicated
by coimmunoprecipitation experiments (27a). This is
consistent with the reported lack of a functional kinase domain in
erbB3 (8). Receptor activation led to the stimulation of the
MEK-MAP kinase pathway, PAK65, a component of the stress-activated signaling pathway (1, 38), p70RSK,
and p95RSK2. Activation of the last kinase was
inhibited by treatment with the MEK inhibitor PD98057, consistent with
earlier reports demonstrating that p95RSK2 is a
target for phosphorylation and activation by MAP kinase (36). In-gel kinase assays indicated that this enzyme was
also responsible for the heregulin-activated CREB kinase activity that was observed. In PC12 and other cells p95RSK2
has been shown to function as an insulin- and nerve growth
factor-activated CREB kinase (36). In Schwann cells,
activation of this kinase by heregulin (in the absence of
forskolin) was transient. This correlated with a transient increase
in accumulation of phospho-CREB. A somewhat paradoxical finding was
that heregulin was a better stimulus for CREB phosphorylation than
forskolin, at least at concentrations that were sufficient to fully
potentiate heregulin-dependent proliferation.
The observation that long-term exposure to heregulin and forskolin was
required to achieve Schwann cell proliferation suggests a requirement
for a change in gene expression. The ability of heregulin and forskolin
to produce sustained cyclin D accumulation and Schwann cell division
correlated with the maintenance of a high level of phospho-CREB, the
transcriptionally activated form of this DNA-binding protein. The
observed correlation between sustained CREB phosphorylation and cyclin
D expression is consistent with the presence of a CRE site in the
cyclin D3 promoter. This site has been shown to be functional in
transcriptional activation in lymphoma cells (37).
The mechanism by which combined heregulin and forskolin treatment leads
to sustained CREB phosphorylation is not known. The principal CREB
kinase in Schwann cells appears to be p95RSK2,
which is activated by heregulin via MAP kinase. Forskolin, at concentrations that produced maximal stimulation of cell proliferation (when added with heregulin), only weakly stimulated CREB
phosphorylation. This result suggests that forskolin-dependent
activation of PKA is not an important pathway for CREB phosphorylation
in Schwann cells. If forskolin is not activating the CREB kinase, then
what is its role in this process? Several mechanisms could account for
the synergistic effect of forskolin and heregulin on phospho-CREB accumulation. One of these is cAMP-mediated inhibition of phospho-CREB phosphatase activity. Indirect evidence for this mechanism comes from
the preliminary finding that treatment of Schwann cells with a
phosphatase inhibitor increases cyclin D transcription in cells stimulated with heregulin (27a). Other possible mechanisms
include forskolin-dependent activation of a kinase that is distinct
from p95RSK2 or PKA and PKA-dependent activation
of p95RSK2. Additional experiments will be
required to resolve these questions.
cAMP is an important regulator of Schwann cell phenotype (6, 12,
20, 23). Surprisingly, there is little or no information on the
physiological mechanisms that regulate adenylyl cyclase activity in
Schwann cells. Schwann cells respond to isoproterenol to produce a
transient elevation of cAMP levels (3a). The
-adrenergic agonist isoproterenol cannot replace forskolin in promoting
heregulin-dependent Schwann cell proliferation, however. In contrast,
cholera toxin and 8-Br-cAMP produced Schwann cell proliferation to
levels comparable to forskolin. An important difference between these
agents and isoproterenol is their ability to generate a sustained
elevation of cAMP levels. The
-adrenergic receptor is subject to
rapid downregulation (15) and attenuation of adenylyl
cyclase activation.
It is important to note that nerve cell-stimulated Schwann cell
proliferation does not require an exogenous cAMP-elevating cofactor
(26). This is in contrast with virtually all purified mitogens, which are inactive in the absence of such a cofactor. There
is convincing evidence that neuronal mitogen is a heregulin (5, 9,
21). This suggests, therefore, that nerve cells also produce an
agent that functions as a cAMP agonist. The nature and identity of this
factor are not known.
 |
ACKNOWLEDGMENT |
This work was supported by Public Health Service grant NS21925 to
D.J.C.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Henry Hood
Research Program, Weis Center for Research, Penn State College of
Medicine, Danville, PA 17822-2613. Phone: (717) 271-6679. Fax: (717)
271-6701. E-mail: djc{at}psghs.edu.
 |
REFERENCES |
| 1.
|
Bagrodia, S.,
B. Derijard,
R. J. Davis, and R. A. Cerione.
1995.
Cdc42 and PAK-mediated signaling lead to jun kinase and p38 mitogen-activated protein kinase activation.
J. Biol. Chem.
270:27995-27998[Abstract/Free Full Text].
|
| 2.
|
Barbacci, E. G.,
B. C. Guarino,
J. G. Stroh,
D. H. Singleton,
K. J. Rosnack,
J. D. Moyer, and G. C. Andrews.
1995.
The structural basis for the specificity of epidermal growth factor and heregulin binding.
J. Biol. Chem.
270:9585-9589[Abstract/Free Full Text].
|
| 3.
|
Barlat, I.,
B. Henglein,
A. Plet,
N. Lamb,
A. Fernandez,
F. McKenzie,
J. Pouyssegur,
A. Vie, and J. M. Blanchard.
1995.
TGF-beta1 and cAMP attenuate cyclin A gene transcription via a cAMP responsive element through independent pathways.
Oncogene
11:1309-1318[Medline].
|
| 3a.
| Bendt, K. M., M. Rahmatullah, and D. J. Carey.
Unpublished data.
|
| 4.
|
Carey, D. J., and R. C. Stahl.
1990.
Identification of a lipid-anchored heparan sulfate proteoglycan in Schwann cells.
J. Cell. Biol.
111:2053-2062[Abstract/Free Full Text].
|
| 5.
|
Dong, Z.,
A. Brennan,
N. Liu,
Y. Yarden,
G. Lefkowitz,
R. Mirsky, and K. R. Jessen.
1995.
Neu differentiation factor is a neuron-glia signal and regulates survival, proliferation, and maturation of rat Schwann cell precursors.
Neuron
15:585-596[Medline].
|
| 6.
|
Eccleston, P. A.
1992.
Regulation of Schwann cell proliferation: mechanisms involved in peripheral nerve development.
Exp. Cell Res.
199:1-9[Medline].
|
| 7.
|
Ginty, D. D.,
A. Bonni, and M. E. Greenberg.
1994.
Nerve growth factor activates a ras-dependent protein kinase that stimulates c-fos transcription via phosphorylation of CREB.
Cell
77:713-725[Medline].
|
| 8.
|
Guy, P. M.,
J. V. Platko,
L. C. Cantley,
R. A. Cerione, and K. L. Carraway, III.
1994.
Insect cell-expressed p180erbB3 possesses an impaired tyrosine kinase activity.
Proc. Natl. Acad. Sci. USA
91:8132-8136[Abstract/Free Full Text].
|
| 9.
|
Ho, W.-H.,
M. P. Armanini,
A. Nuijens,
H. S. Phillips, and P. L. Osheroff.
1995.
Sensory and motor neuron-derived factor: a novel heregulin variant highly expressed in sensory and motor neurons.
J. Biol. Chem.
270:14523-14532[Abstract/Free Full Text].
|
| 10.
|
Holmes, W. E.,
M. X. Sliwkowski,
R. W. Akita,
W. J. Henzel,
J. Lee,
J. W. Park,
D. Yansura,
N. Abadi,
H. Raab,
G. D. Lewis,
H. M. Shepard,
W.-J. Kuang,
W. I. Wood,
D. V. Goeddel, and R. L. Vandlen.
1992.
Identification of heregulin, a specific activator of p185erbB2.
Science
256:1205-1210[Abstract/Free Full Text].
|
| 11.
|
Kamesita, I., and H. Fujisawa.
1989.
A sensitive method for detection of calmodulin-dependent protein kinase II activity in sodium dodecyl sulfate gel.
Anal. Biochem.
183:139-143[Medline].
|
| 12.
|
Kim, H. A.,
J. E. DeClue, and N. Ratner.
1997.
cAMP-dependent protein kinase A is required for Schwann cell growth: interactions between the cAMP and neuregulin/tyrosine kinase pathways.
J. Neurosci. Res.
49:236-247[Medline].
|
| 13.
|
L'Allemain, G.,
J. N. Lavoie,
V. Baldin, and J. Pouyssegur.
1997.
Cyclin D1 expression is a major target of the cAMP-induced inhibition of cell cycle entry in fibroblasts.
Oncogene
14:1981-1990[Medline].
|
| 14.
|
Lamy, F.,
F. Wilkin,
M. Baptist,
J. Posada,
P. P. Roger, and J. E. Dumont.
1993.
Phosphorylation of mitogen activated protein kinases is involved in the epidermal growth factor and phorbol ester, but not in the thyrotropin/cAMP, thyroid mitogenic pathway.
J. Biol. Chem.
268:8398-8401[Abstract/Free Full Text].
|
| 15.
|
Lohse, M. J.,
J. L. Benovic,
M. G. Caron, and R. J. Lefkowitz.
1990.
Multiple pathways of rapid 2-adrenergic receptor desensitization: delineation with specific inhibitors.
J. Biol. Chem.
265:3202-3211[Abstract/Free Full Text].
|
| 16.
|
Lukas, J.,
J. Bartkova, and J. Bartek.
1996.
Convergence of mitogenic signalling cascades from diverse classes of receptors at the cyclin D-cyclin-dependent kinase-pRb-controlled G1 checkpoint.
Mol. Cell. Biol.
16:6917-6925[Abstract].
|
| 17.
|
Marchionni, M. A.,
A. D. J. Goodearl,
M. S. Chen,
O. Bermingham-Mcdonogh,
C. Kirk,
M. Hendricks,
F. Danehy,
D. Misumi,
J. Sudhalter,
K. Kobayashi,
D. Wroblewski,
C. Lynch,
M. Baldassare,
I. Hiles,
J. B. Davis,
J. J. Hsuan,
N. F. Totty,
M. Otsu,
R. N. McBurney,
M. D. Waterfield,
P. Stroobant, and D. Gwynne.
1993.
Glial growth factors are alternatively spliced erbB2 ligands expressed in the nervous system.
Nature (London)
362:312-318[Medline].
|
| 18.
|
Meyer, D.,
T. Yamaai,
A. Garratt,
E. Reithmacher-Sonnenberg,
D. Kane,
L. E. Theill, and C. Birchmeier.
1997.
Isoform-specific expression and function of neuregulin.
Development
124:3575-3586[Abstract].
|
| 19.
|
Montminy, M.
1997.
Transcriptional regulation by cyclic AMP.
Annu. Rev. Biochem.
66:807-822[Medline].
|
| 20.
|
Morgan, L.,
K. R. Jessen, and R. Mirsky.
1991.
The effects of cAMP on differentiation of cultured Schwann cells: progression from an early phenotype (O4+) to a myelin phenotype (Po+, GFAP , N-CAM , NGF-Receptor ) depends on growth inhibition.
J. Cell Biol.
112:457-467[Abstract/Free Full Text].
|
| 21.
|
Morissey, T. K.,
A. D. O. Levi,
A. Nuijens,
M. X. Sliwkowski, and R. P. Bunge.
1995.
Axon-induced mitogenesis of human Schwann cells involves heregulin and p185-erbB2.
Proc. Natl. Acad. Sci. USA
92:1431-1435[Abstract/Free Full Text].
|
| 22.
|
Pages, G.,
P. Lenormand,
G. L'Allemain,
J.-C. Chambard,
S. Meloche, and J. Pouyssegur.
1993.
Mitogen-activated protein kinases p42mapk and p44mapk are required for fibroblast proliferation.
Proc. Natl. Acad. Sci. USA
90:8319-8323[Abstract/Free Full Text].
|
| 23.
|
Raff, M. C.,
E. Abney,
J. P. Brockes, and A. Hornby-Smith.
1978.
Schwann cell growth factors.
Cell
15:813-822[Medline].
|
| 24.
|
Ratner, N.,
R. P. Bunge, and L. Glaser.
1985.
A neuronal cell surface heparan sulfate proteoglycan is required for dorsal root ganglion neuron stimulation of Schwann cell proliferation.
J. Cell Biol.
101:744-754[Abstract/Free Full Text].
|
| 25.
|
Reise, D. J., II,
T. M. van Raaij,
G. D. Plowman,
G. C. Andrews, and D. F. Stern.
1995.
The cellular response to neuregulins is governed by complex interactions of the erbB receptor family.
Mol. Cell. Biol.
15:5770-5776[Abstract].
|
| 26.
|
Salzer, J. L., and R. P. Bunge.
1980.
Studies of Schwann cell proliferation. I. An analysis in tissue culture of proliferation during development, Wallerian degeneration, and direct injury.
J. Cell Biol.
84:739-752[Abstract/Free Full Text].
|
| 27.
|
Salzer, J. L.,
R. P. Bunge, and L. Glaser.
1980.
Studies of Schwann cell proliferation. III. Evidence for the surface localization of the neurite mitogen.
J. Cell Biol.
84:767-778[Abstract/Free Full Text].
|
| 27a.
| Schroering, A., and D. J. Carey. Unpublished
data.
|
| 28.
|
Sherr, C. J.
1996.
Cancer cell cycles.
Science
274:1672-1677[Abstract/Free Full Text].
|
| 29.
|
Syroid, D. E.,
P. R. Maycox,
P. G. Burrola,
N. Liu,
D. Wen,
K.-F. Lee,
G. Lemke, and T. J. Kilpatrick.
1996.
Cell death in the Schwann cell lineage and its regulation by neuregulin.
Proc. Natl. Acad. Sci. USA
93:9229-9234[Abstract/Free Full Text].
|
| 30.
|
Tsakiridis, T.,
C. Taha,
S. Grinstein, and A. Klep.
1996.
Insulin activates a p21-activated kinase in muscle cells via phosphatidylinositol 3-kinase.
J. Biol. Chem.
271:19664-19667[Abstract/Free Full Text].
|
| 31.
|
Vaillancourt, R. R.,
A. M. Gardner, and G. L. Johnson.
1994.
B-Raf-dependent regulation of the MEK-1/mitogen-activated protein kinase pathway in PC12 cells and regulation by cyclic AMP.
Mol. Cell. Biol.
14:6522-6530[Abstract/Free Full Text].
|
| 32.
|
Vartanian, T.,
A. Goodearl,
A. Viehover, and G. Fischbach.
1997.
Axonal neuregulin signals cells of the oligodendrocyte lineage through activation of HER4 and Schwann cells through HER2 and HER3.
J. Cell Biol.
137:211-220[Abstract/Free Full Text].
|
| 33.
|
Weinberg, R. A.
1995.
The retinoblastoma protein and cell cycle control.
Cell
81:323-330[Medline].
|
| 34.
|
Weinmaster, G., and G. Lemke.
1990.
Cell specific cAMP-mediated induction of the PDGF receptor.
EMBO J.
9:915-920[Medline].
|
| 35.
|
Wood, P., and R. P. Bunge.
1975.
Evidence that sensory axons are mitogenic for Schwann cells.
Nature (London)
256:662-664[Medline].
|
| 36.
|
Xiong, Y.,
D. D. Ginty, and M. E. Greenberg.
1996.
Coupling of the RAS-MAPK pathway to gene activation by RKS2, a growth factor-regulated CREB kinase.
Science
273:959-963[Abstract].
|
| 37.
|
Yang, M.,
Y. Hosakawa,
S. Kaneko,
M. Tanaka, and K. Nakashima.
1996.
Structure and characterization of rat cyclin D3 promoter.
Gene
181:153-159[Medline].
|
| 38.
|
Zhang, S.,
J. Han,
M. A. Sells,
J. Chernoff,
U. G. Knauss,
R. J. Ulevitch, and G. M. Bokoch.
1995.
Rho family GTPases regulate p38 mitogen-activated protein kinase through the downstream mediator Pak1.
J. Biol. Chem.
270:23932-23936.
|
Molecular and Cellular Biology, November 1998, p. 6245-6252, Vol. 18, No. 11
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Freidin, M., Asche, S., Bargiello, T. A., Bennett, M. V. L., Abrams, C. K.
(2009). Connexin 32 increases the proliferative response of Schwann cells to neuregulin-1 (Nrg1). Proc. Natl. Acad. Sci. USA
106: 3567-3572
[Abstract]
[Full Text]
-
Kao, S.-C., Wu, H., Xie, J., Chang, C.-P., Ranish, J. A., Graef, I. A., Crabtree, G. R.
(2009). Calcineurin/NFAT Signaling Is Required for Neuregulin-Regulated Schwann Cell Differentiation. Science
323: 651-654
[Abstract]
[Full Text]
-
Monje, P. V., Athauda, G., Wood, P. M.
(2008). Protein Kinase A-mediated Gating of Neuregulin-dependent ErbB2-ErbB3 Activation Underlies the Synergistic Action of cAMP on Schwann Cell Proliferation. J. Biol. Chem.
283: 34087-34100
[Abstract]
[Full Text]
-
Yoon, C., Korade, Z., Carter, B. D.
(2008). Protein Kinase A-Induced Phosphorylation of the p65 Subunit of Nuclear Factor-{kappa}B Promotes Schwann Cell Differentiation into a Myelinating Phenotype. J. Neurosci.
28: 3738-3746
[Abstract]
[Full Text]
-
Atanasoski, S., Scherer, S. S., Sirkowski, E., Leone, D., Garratt, A. N., Birchmeier, C., Suter, U.
(2006). ErbB2 Signaling in Schwann Cells Is Mostly Dispensable for Maintenance of Myelinated Peripheral Nerves and Proliferation of Adult Schwann Cells after Injury. J. Neurosci.
26: 2124-2131
[Abstract]
[Full Text]
-
Chernousov, M. A., Stahl, R. C., Carey, D. J.
(2001). Schwann Cell Type V Collagen Inhibits Axonal Outgrowth and Promotes Schwann Cell Migration via Distinct Adhesive Activities of the Collagen and Noncollagen Domains. J. Neurosci.
21: 6125-6135
[Abstract]
[Full Text]
-
Chuenkova, M. V., Furnari, F. B., Cavenee, W. K., Pereira, M. A.
(2001). Trypanosoma cruzi trans-sialidase: A potent and specific survival factor for human Schwann cells by means of phosphatidylinositol 3-kinase/Akt signaling. Proc. Natl. Acad. Sci. USA
10.1073/pnas.161298398v1
[Abstract]
[Full Text]
-
Montcouquiol, M., Corwin, J. T.
(2001). Brief Treatments with Forskolin Enhance S-Phase Entry in Balance Epithelia from the Ears of Rats. J. Neurosci.
21: 974-982
[Abstract]
[Full Text]
-
Serra, E., Rosenbaum, T., Winner, U., Aledo, R., Ars, E., Estivill, X., Lenard, H.-G., Lazaro, C.
(2000). Schwann cells harbor the somatic NF1 mutation in neurofibromas: evidence of two different Schwann cell subpopulations. Hum Mol Genet
9: 3055-3064
[Abstract]
[Full Text]
-
Sherman, L. S., Rizvi, T. A., Karyala, S., Ratner, N.
(2000). Cd44 Enhances Neuregulin Signaling by Schwann Cells. JCB
150: 1071-1084
[Abstract]
[Full Text]
-
Maurel, P., Salzer, J. L.
(2000). Axonal Regulation of Schwann Cell Proliferation and Survival and the Initial Events of Myelination Requires PI 3-Kinase Activity. J. Neurosci.
20: 4635-4645
[Abstract]
[Full Text]
-
Howe, D. G., McCarthy, K. D.
(2000). Retroviral Inhibition of cAMP-Dependent Protein Kinase Inhibits Myelination But Not Schwann Cell Mitosis Stimulated by Interaction with Neurons. J. Neurosci.
20: 3513-3521
[Abstract]
[Full Text]