This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yu, J.
Right arrow Articles by Backer, J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yu, J.
Right arrow Articles by Backer, J. M.

 Previous Article  |  Next Article 

Mol Cell Biol, March 1998, p. 1379-1387, Vol. 18, No. 3
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.

Regulation of the p85/p110 Phosphatidylinositol 3'-Kinase: Stabilization and Inhibition of the p110alpha Catalytic Subunit by the p85 Regulatory Subunit

Jinghua Yu, Yitao Zhang, James McIlroy, Tamara Rordorf-Nikolic, George A. Orr, and Jonathan M. Backer*

Department of Molecular Pharmacology, Albert Einstein College of Medicine, Bronx, New York 10461

Received 7 July 1997/Returned for modification 9 September 1997/Accepted 1 December 1997

    ABSTRACT
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

We propose a novel model for the regulation of the p85/p110alpha phosphatidylinositol 3'-kinase. In insect cells, the p110alpha catalytic subunit is active as a monomer but its activity is decreased by coexpression with the p85 regulatory subunit. Similarly, the lipid kinase activity of recombinant glutathione S-transferase (GST)-p110alpha is reduced by 65 to 85% upon in vitro reconstitution with p85. Incubation of p110alpha /p85 dimers with phosphotyrosyl peptides restored activity, but only to the level of monomeric p110alpha . These data show that the binding of phosphoproteins to the SH2 domains of p85 activates the p85/p110alpha dimers by inducing a transition from an inhibited to a disinhibited state. In contrast, monomeric p110 had little activity in HEK 293T cells, and its activity was increased 15- to 20-fold by coexpression with p85. However, this apparent requirement for p85 was eliminated by the addition of a bulky tag to the N terminus of p110alpha or by the growth of the HEK 293T cells at 30°C. These nonspecific interventions mimicked the effects of p85 on p110alpha , suggesting that the regulatory subunit acts by stabilizing the overall conformation of the catalytic subunit rather than by inducing a specific activated conformation. This stabilization was directly demonstrated in metabolically labeled HEK 293T cells, in which p85 increased the half-life of p110. Furthermore, p85 protected p110 from thermal inactivation in vitro. Importantly, when we examined the effect of p85 on GST-p110alpha in mammalian cells at 30°C, culture conditions that stabilize the catalytic subunit and that are similar to the conditions used for insect cells, we found that p85 inhibited p110alpha . Thus, we have experimentally distinguished two effects of p85 on p110alpha : conformational stabilization of the catalytic subunit and inhibition of its lipid kinase activity. Our data reconcile the apparent conflict between previous studies of insect versus mammalian cells and show that p110alpha is both stabilized and inhibited by dimerization with p85.

    INTRODUCTION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

Phosphatidylinositol (PI) 3'-kinases constitute a family of enzymes that mediate intracellular signaling initiated by receptor tyrosine kinases and heterotrimeric G-protein-coupled receptors. Activation of PI 3'-kinase leads to increases in the intracellular levels of PI[3,4]P2 and PI[3,4,5]P3, which are presumed second messengers (4). PI 3'-kinases have been implicated in the control of proliferation, cytoskeletal organization, apoptosis, and vesicular trafficking (6, 16, 20, 31, 46).

A classification of PI 3'-kinases has been described by Zvelebil and coworkers (48). The class I enzymes are heterodimeric proteins that are composed of separate regulatory and catalytic subunits and that utilize PI, PI[4]P, and PI[4,5]P2 as substrates. Class I enzymes include the p85/p110 PI 3'-kinase, which is activated by binding to phosphotyrosyl proteins, and the p101/p120 PI 3-kinase-gamma isoform, which is activated by beta gamma subunits from trimeric G proteins (11, 13, 38, 39). Class II PI 3'-kinases contain C-terminal C2 domains and preferentially utilize PI and PI[4]P as substrates (24, 26, 43). Class III enzymes include the yeast VPS34 and its mammalian homolog (35, 44) and recognize PI but not higher-order phosphoinositides as substrates.

Regulation of the p85/p110 PI 3'-kinase is complex. Two homologous p85 regulatory subunits have been identified (9, 27, 36). Each contains an N-terminal SH3 domain followed by a proline rich domain, a breakpoint cluster region (BCR) homology domain, a second proline-rich domain, and two SH2 domains. Shorter forms (p55) lacking the SH3 and BCR homology domains have also been cloned (1, 29). All the p85/p55 proteins contain putative coiled-coil domains that mediate stable dimerization with the p110 catalytic subunit (7). The three known isoforms of p110 catalytic subunits (p110alpha , p110beta , and p110delta ) contain closely spaced N-terminal binding sites for p85 and p21ras-GTP, as well as C-terminal kinase domains (12, 14, 18, 32, 42). In vitro studies have shown that the p85 SH3 domain binds to proline-rich peptides, the proline-rich domains bind to SH3 domains from Fyn and Lyn, the BCR homology domain binds to GTP-loaded CDC42, and the SH2 domains bind to tyrosyl phosphopeptides (3, 17, 37, 41, 47). Each of these binding events activates p85/p110alpha PI 3'-kinase in vitro, although it is not clear yet whether these distinct activating interactions are redundant or additive (2, 10, 28, 47). p110alpha binding to p21ras-GTP was also found to increase PI 3'-kinase activity in an in vitro assay using lipid vesicles as the substrates (32). However, this increase in activity may reflect the targeting of p110alpha to the lipid vesicles, since nonisoprenylated GTP-ras binds to p110 but does not activate it in vitro.

The p85 regulatory subunit of PI 3'-kinase has been generally viewed as an activator of p110alpha . Several groups have reported that p110alpha is catalytically inactive as a monomer in Cos cells and requires coexpression with p85 for activity (11, 18). In fact, the p110alpha binding domain from p85 (the inter-SH2 [iSH2] domain) has been tethered to the N terminus of p110alpha to produce a constitutively active PI 3'-kinase (15). However, p110alpha is active when expressed in baculovirus-infected Sf-9 cells (11). In addition, p110beta is active as a monomer in HEK 293T cells (13). Interestingly, the studies reporting that p110alpha is inactive as a monomer in mammalian cells used C-terminal tags or C-terminally directed antibodies, whereas the study reporting active monomeric p110beta used an N-terminal tag inserted between residues 30 and 31 (11, 13, 15, 18).

In this study, we have examined the mechanism by which p85 regulates p110alpha activity. In insect cells, p110alpha is an active monomer that is reversibly inhibited by stable binding to p85. Activation of recombinant p85/p110alpha by phosphotyrosyl proteins reflects a disinhibition of the p85/p110alpha dimer. In contrast, monomeric p110 had little activity in HEK 293T cells, and its activity was increased 15- to 20-fold by coexpression with p85. However, this requirement can be completely supplanted by either the addition of an N-terminal glutathione S-transferase (GST) tag or culture of the mammalian cells at 30°C. Under conditions that stabilize monomeric p110alpha in mammalian cells (GST-p110alpha in cells grown at 30°C), coexpression of GST-p110alpha with p85 causes an inhibition of activity similar to that seen in insect cells. Our data show that p85 acts by both stabilizing and inhibiting the p110alpha catalytic subunit.

    MATERIALS AND METHODS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

Antibodies and Western blotting. Affinity-purified rabbit antibodies against residues 324 to 721 of human p85 have been previously described (2). Antibodies against p110alpha (AE-40) were produced by immunizing rabbits with a GST fusion protein containing residues 1 to 140 of bovine p110alpha . The antibodies were affinity purified with a column made by coupling the same GST fusion protein to Affigel (Bio-Rad). All Western blots were visualized with primary and secondary antibodies (where required) and 125I-protein A (New England Nuclear) and quantitated with a Molecular Dynamics PhosphorImager.

Mutagenesis of p85 and p110. Construction of N-terminally hemagglutinin (HA)-tagged p85 has been previously described (33). Mutation of Ser-608 to alanine was performed by the method of Kunkel et al. (23). Bovine p110alpha (provided by M. Waterfield, Ludwig Institute for Cancer Research) was mutated with the pALTER system (Promega). A new XhoI site was inserted between the first and second codons of the p110alpha cDNA, which allowed the insertion of double-stranded cassettes between an upstream BamHI site and the XhoI site. The cassettes contained an idealized Kozak sequence (21, 22) followed by the initial ATG and the various epitope tags. The myc tag was inserted with anticomplementary synthetic oligonucleotides. The Tris-HA tag was subcloned from a vector provided by E. Skolnik, New York University, by PCR. The GST tag was subcloned from the pGEX-2T vector (Pharmacia) by using PCR. The resulting sequences, inserted immediately N-terminal to Pro-2 of p110alpha , were as follows: p110alpha /N-myc-p110: MAEEQKLISEEDLRRG; 3HA-p110alpha : MPRGGGRIFYPYDVPDTAGYPYDVPDYAGSTPYDVPDYAAQCGRARG; GST-p110alpha : M-(GST)-LVPRGSRG. To produce C-terminally myc-tagged p110alpha , a new BglII site was inserted immediately 5' to the stop codon of the p110alpha cDNA, and anticomplementary synthetic nucleotides were used to insert the sequence RSDLGEQKLISEEDLG-STOP. All constructions were confirmed by sequencing. The p110alpha cDNA constructs were subcloned into the pSG5 expression vector (Stratagene) for expression in mammalian cells; the HA-p85 cDNA construct was subcloned into the expression vector pCMVhis (40). All plasmids were purified by equilibrium centrifugation in CsCl.

Preparation of recombinant PI 3'-kinase in Sf-9 cells. The p85 and p110alpha gene constructs were subcloned into pBluebacIII (Invitrogen) and cotransfected into Sf-9 cells with Baculogold (Pharmingen) linearized baculovirus DNA, which contains a lethal mutation rescued by recombination with the baculovirus transfer vector. Recombinant virus was amplified 2 or 3 times to produce high-titer stocks. To produce the recombinant proteins, Sf-9 cells were grown in six-well dishes and infected with recombinant baculovirus. After 3 days in culture, the cells were washed in ice-cold phosphate-buffered saline and lysed by cycles of freezing and thawing in 10 mM Tris (pH 7.4)-150 mM NaCl-1 mM EDTA-100 µg of aprotinin per ml-1 µg of leupeptin per ml-350 µg of phenylmethylsulfonyl fluoride per ml (baculolysis buffer). After removal of particulate material by centrifugation at 12,000 × g, the lysates were assayed directly for PI 3'-kinase activity with sonicated bovine liver PI (200 µg/ml) and ATP (45 µM) as described by Ruderman et al. (34).

Purification of GST-p110. Sf-9 cells, grown in two 15-cm-diameter dishes, were infected with GST-p110alpha baculovirus. After 48 h, the cells were lysed in 20 mM Tris (pH 7.5)-137 mM NaCl-1 mM CaCl2-1 mM MgCl2-1% Nonidet P-40 (NP-40)-10% glycerol (NP-40 lysis buffer). After centrifugation at 12,000 × g to remove particulate material, the lysate was passed twice over glutathione-Sepharose, washed with 20 column volumes of 10 mM Tris (pH 7.4)-150 mM NaCl, and eluted with 50 mM Tris (pH 7.4) containing 10 mM glutathione. The eluate was assayed directly for lipid kinase activity; control experiments showed that this buffer did not affect the activity of recombinant p110alpha . Peak fractions were assayed in the absence or presence of p85 as described above.

p85 and p110alpha mixing and coexpression experiments. Lysates from Sf-9 cells expressing wild-type p85 or mutant p85 or lysates from uninfected Sf-9 cells (approximately 20 µg of protein) were mixed with lysates from Sf-9 cells expressing wild-type or tagged p110alpha (approximately 60 µg of total protein). After 30 min on ice, the samples were assayed for PI 3'-kinase activity as described below. Where indicated, the p85 was first immunopurified by absorption onto protein A-Sepharose with an antibody that recognizes the C-terminal SH2 domain of p85 antibody; we have previously shown that this antibody does not affect p85/p110 activity (25). p110 activity was measured in the presence of the washed p85/protein A beads. Alternatively, Sf-9 cells were coinfected with baculovirus coding for p110alpha and p85. Duplicate samples were assayed for PI 3'-kinase activity as previously described (34); assays used mixtures including 10 mM MgCL2, 40 µM ATP containing 20 µCi of [32P]ATP/assay, and 200 µM PI. Background lipid kinase activity present in lysates from uninfected Sf-9 cells was subtracted. Parallel samples were assayed for p110alpha expression by immunoblotting with anti-p110alpha antibodies. For analysis of PI[4]P and PI[4,5]P2 phosphorylation, assays contained sonicated mixtures of 10 µg of phosphatidylserine, 5 µg of PI, and 10 µg of either PI[4]P or PI[4,5]P2 and were conducted with 500 µM ATP. After extraction in acidic chloroform-methanol (1:1), the organic phase was washed with 1 volume of synthetic upper phase and analyzed by thin-layer chromatography in 1-propanol-2 M acetic acid (65:35).

PI 3'-kinase kinetic analysis. Recombinant p110alpha monomers were incubated in the absence or presence of wild-type or mutant p85 as described above and then incubated for an additional 60 min in the absence or presence of a 1 µM concentration of a bisphosphopeptide derived from p85 binding sequences in IRS-1 [DD(P)YMPMSPGAGAGAGAGAGNGD(P)YMPMSPKS] (33). For the kinetic analysis with variable lipid concentrations (Fig. 2 and Table 1), the mixtures were assayed in a solution containing 10 mM MgCl2, 1 mM ATP, 20 µCi of [32P]ATP per assay, and 0 to 1,000 µM PI. For the kinetic analysis with variable ATP, the mixtures were assayed in a solution containing 10 mM MgCl2, 20 µCi of [32P]ATP per assay, 400 µM phospholipid, and 0 to 600 µM ATP. After 10 min at 22°C, the lipids were extracted and lipid kinase activity was measured (34). Incorporation of [32P]ATP into the phospholipid was quantitated with a Molecular Dynamics PhosphorImager, and the result was converted to counts per minute by quantifying serial dilutions of [32P]ATP with the PhosphorImager. All determinations were made in duplicate. Kinetic analysis was performed with Kaleidograph software.

Analysis of p85 serine phosphorylation. Sf-9 cells were infected with p85 baculovirus. After 48 h, the cells were washed into phosphate-free Graces medium and incubated with [32P]orthophosphate (0.5 mCi/ml) for 4 h. The cells were lysed as described above in baculolysis buffer containing 100 mM NaF, 10 mM sodium pyrophosphate, and 100 µM orthovanadate. Alternatively, the cells were lysed in buffer without phosphatase inhibitors and then incubated for 1 h at 30°C in 2 mM dithiothreitol-2 mM MnCl2-0.5 µg of recombinant protein phosphatase 1 (provided by Z.-Y. Zhang, Albert Einstein College of Medicine). The proteins were diluted to 0.5 ml, immunoprecipitated with anti-p85 antibody and protein A-Sepharose, eluted in sample buffer, and separated by reducing sodium dodecyl sulfate-7.5% polyacrylamide gel electrophoresis (SDS-7.5% PAGE). Proteins were visualized by autoradiography, and 32P incorporation was quantitated with a Molecular Dynamics PhosphorImager.

Production of recombinant PI 3'-kinase in HEK 293T cells. Confluent HEK 293T cells (provided by J. Krolewski, Columbia University) were split 1:10 24 h prior to transfection, preincubated in 25 µM chloroquine, and transfected with 30 to 45 µg of expression vectors for N-myc-p110alpha , C-myc-p110alpha , 3HA-p110alpha , GST-p110alpha , and p85 or with empty vector by a calcium-phosphate precipitation method. After 48 h the cells were solubilized, and PI 3'-kinase was immunoprecipitated with monoclonal anti-myc antibody (9E10; Oncogene Science), monoclonal anti-HA antibody (12CA5), or polyclonal anti-GST antibody (Pharmacia). After absorption of the lysate to protein G-Sepharose beads (Pharmacia), the beads were washed and lipid kinase activity was determined as described by Ruderman et al. (34), with quantitation with a Molecular Dynamics PhosphorImager. All determinations were made in triplicate. Immunoprecipitates from parallel samples were blotted with anti-p110alpha or anti-p85 antibodies.

Metabolic labeling experiments. HEK 293T cells were transfected with expression vectors for C-myc-p110 in the absence or presence of p85 as described above. Thirty-six hours after transfection, the cells were incubated in methionine-free medium containing 10% fetal bovine serum and 0.1 mCi of [35S]methionine for 16 h. The cells were then washed with phosphate-buffered saline and lysed or incubated for various times in complete medium supplemented with 10× methionine. The cells were lysed, and proteins were immunoprecipitated with anti-myc antibodies and protein G-Sepharose beads eluted, separated by SDS-PAGE, and visualized by autoradiography.

Heat inactivation. Recombinant wild-type p110 was produced in Sf-9 cells and incubated in buffer without or with recombinant p85 for 1 h at 4°C. The samples were then shifted to the indicated temperatures for 30 min, chilled on ice, and assayed for lipid kinase activity as described above.

    RESULTS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

p110alpha is active as a monomer in insect cells and is inhibited by coexpression or reconstitution with p85. We examined the effects of p85 on p110alpha activity by using recombinant proteins expressed in baculovirus-infected Sf-9 cells. p110alpha showed significant activity in the absence of p85, consistent with previous reports (11) (Fig. 1A). Coexpression with p85 increased the amount of p110alpha protein in Sf-9 lysates (Fig. 1B) but decreased its activity dramatically (Fig. 1A), suggesting that p110alpha was inhibited by p85.


View larger version (32K):
[in this window]
[in a new window]
 
FIG. 1.   Expression of p110alpha in Sf-9 cells. (A) Control Sf-9 cells or p110alpha baculovirus-infected Sf-9 cells were additionally infected without the p85 baculovirus or not infected. The cells were lysed, and PI 3'-kinase activities in the lysate were measured. (B) Western blot of parallel samples with anti-p110alpha antibody. (C) Left panel: control Sf-9 lysates, lysates from cells expressing GST-p110alpha , or glutathione-Sepharose-purified GST-p110alpha was mixed with lysates from cells expressing p85 as indicated. Lipid kinase activity was then measured. Right panel: control Sf-9 lysates, lysates from cells expressing GST-p110alpha , or glutathione-Sepharose-purified GST-p110alpha was mixed with immunopurified p85 as indicated, and PI 3'-kinase activities were measured. All determinations were made in triplicate, and the data are the means ± standard errors of the means from three experiments.

We reconstituted the p85-induced inhibition of p110alpha by producing the proteins separately in Sf-9 cells and then mixing them in vitro; p110alpha could be immunoprecipitated with anti-p85 antibodies under these conditions, demonstrating that the two formed a complex (data not shown). Incubation of GST-p110alpha with HA-tagged p85 caused an 80% decrease in lipid kinase activity (Fig. 1C, lane c). To show that the inhibition was not due to contaminating factors in the Sf-9 cytosol, we purified an identical amount of GST-p110alpha by absorption on glutathione-Sepharose beads. Total p110alpha activity was reduced slightly, reflecting the loss of some GST-p110alpha from the beads during the washes (lane d). However, the purified GST-p110alpha was still inhibited by incubation with p85 (lanes e and j). Similarly, we purified p85 by absorption with a highly specific anti-p85 antibody and showed that the immunopurified p85 inhibited GST-p110alpha activity in Sf-9 lysates (lane h) and in glutathione-Sepharose-purified GST-p110alpha (lane j). These data show that the inhibition of p110alpha by p85 does not require coexpression, as has been previously suggested (45). Moreover, purification of p110alpha and p85 had no effect on the inhibition of p110alpha by p85. Subsequent experiments were performed with p110alpha and p85 in Sf-9 lysates, as purified GST-p110alpha was unstable and lost activity rapidly with storage (data not shown).

We measured the activity of p110alpha and p85/p110alpha dimers in the absence or presence of a bisphosphopeptide that activates heterodimeric PI 3'-kinase in vitro (33). Substrate velocity curves, measured in the presence of 1 mM ATP or 400 µM sonicated PI, were obtained for PI and ATP, respectively. A representative curve for PI is shown in Fig. 2, and the calculated kinetic data are shown in Table 1. The addition of p85 to p110alpha significantly decreased the utilization of both PI and ATP as substrates. Relative Vmax/Km values for PI and ATP decreased by 85 and 60%, respectively, compared to those seen with p110alpha monomers. The addition of bisphosphopeptide (Fig. 2A; Table 1) restored the relative Vmax/Km values for lipid and ATP to 75 and 95%, respectively, of those seen with p110alpha monomers. However, the activity of p85/p110alpha dimers in the presence of activating phosphopeptide was never greater than the activity of an equivalent amount of monomeric p110alpha . The activity of monomeric p110alpha was not affected by phosphopeptide (data not shown). The inhibition of p110alpha by p85 was confirmed by using PI[4]P and PI[4,5]P2 as the substrates (Fig. 2B). The addition of p85 inhibited p110alpha activity by 50 and 70% with PI[4]P and PI[4,5]P2, respectively. The addition of bisphosphopeptide increased the activity of p85/p110alpha dimers to 108 and 50%, respectively, of that seen with p110alpha monomers.


View larger version (22K):
[in this window]
[in a new window]
 
FIG. 2.   Lipid kinase activities of p110alpha monomers and p85/p110alpha dimers. (A) N-myc p110alpha monomers were incubated for 30 min at 4°C in the absence or presence of p85 and then incubated for an additional 60 min at 4°C in the absence or presence of 1 µM bisphosphopeptide. The mixtures were assayed in the presence of 0 to 1,000 µM PI and 1 mM ATP. After 10 min at 22°C, the lipids were extracted and analyzed as described in Materials and Methods. All determinations were performed in duplicate, and the data are the means from three separate experiments. Curves represent the best Michaelis-Menten fit and were generated with Kaleidograph software. (B) N-myc-p110 monomers or p85/N-myc-p110 dimers were incubated in the absence or presence of phosphopeptide as described above. The samples were assayed with sonicated mixtures of PI,PS and either PI[4]P or PI[4,5]P2 as described in Materials and Methods. The data are the means ± standard errors of the means for two (PIP) or three (PIP2) experiments.

                              
View this table:
[in this window]
[in a new window]
 
TABLE 1.   Kinetic analysis of p110 activitya

These data suggest that p85 inhibits the activity of p110alpha . Subsequent activation of p85/p110alpha dimers by IRS-1 or phosphopeptides reflects a disinhibition of p110alpha rather than a true increase in activity relative to p110alpha monomers.

Inhibition of p110alpha by p85 is independent of serine or threonine phosphorylation. Dhand et al. identified Ser-608 in the iSH2 domain of p85 as an inhibitory regulatory site (8). To determine whether the observed inhibition of p110alpha could be due to phosphorylation of Ser-608, we mutated the residue to alanine. The p85-S608A mutant was expressed in Sf-9 cells as an 85-kDa polypeptide (Fig. 3A) and showed no differences in binding to p110alpha when compared to wild-type p85 (Fig. 3B). p85-S608A was indistinguishable from wild-type p85 with regard to inhibition of p110alpha ; this was observed when monomeric p110alpha was mixed in vitro with either p85 from Sf-9 lysates (Fig. 3C) or immunopurified p85 (Fig. 3D). Similarly, coinfection of Sf-9 cells with either wild-type p85 or p85-S608A increased p110alpha expression (Fig. 3E, inset) but decreased p110alpha activity (Fig. 3E). p85-S608A/p110alpha dimers could be activated by phosphopeptides to the same extent as wild-type p85/p110alpha dimers (Fig. 3F). Although it is possible that phosphorylation of Ser-608 has an additional inhibitory function in the regulation of p110alpha , these data show that the inhibition observed here does not depend on the phosphorylation of this residue.


View larger version (32K):
[in this window]
[in a new window]
 
FIG. 3.   Inhibition of p110alpha by p85-S608A. (A) Expression of wild-type p85 and p85-S608A in Sf-9 lysates was measured by blotting with anti-p85 antibody. (B) Wild-type p85 and p85-S608A were immobilized on anti-p85-protein A-Sepharose beads, incubated with lysates from cells expressing N-myc-p110alpha , washed, and assayed for lipid kinase activity. Lipid kinase activity bound to wild-type p85 was defined as 100%. (C) Lysates from Sf-9 cells expressing N-myc-p110alpha were incubated in the absence or presence of wild-type p85 or p85-S608A and then assayed for lipid kinase activity (expressed as a percentage of lipid kinase activity in the absence of p85). (D) Lysates from Sf-9 cells expressing N-myc-p110alpha were incubated in the absence or presence of immunopurified wild-type p85 or p85-S608A and then assayed for lipid kinase activity (expressed as in panel C). (E) Sf-9 cells were infected with N-myc-p110alpha alone or were coinfected with wild-type p85 or p85-S608A. Lipid kinase activity in the cell lysates was determined (expressed as in panel C). Inset: p110alpha expression was determined by blotting with anti-p110alpha antibody. (F) Lysates containing N-myc-p110alpha and wild-type p85 or p85-S608A were incubated in the absence or presence of bisphosphopeptide (1 µM) for 1 h, and lipid kinase activity was determined. Activation was expressed as fold stimulation over activity in the absence of phosphopeptide. All determinations were made in duplicate or triplicate, and the data are the means ± standard errors of the means of four separate experiments.

To determine whether other potential phosphorylation sites could account for the observed inhibition of p110alpha by p85, we labeled p85-infected Sf-9 cells with [32P]orthophosphate and immunoprecipitated them with anti-p85 antibodies. p85 was phosphorylated in Sf-9 cells but could be completely dephosphorylated by treatment with protein phosphatase 1 (Fig. 4A). Dephosphorylated p85 was fully capable of inhibiting p110alpha when mixed with the enzyme in vitro (Fig. 4B). Our data suggest that phosphorylation of p85 is not required for its inhibition of p110alpha .


View larger version (36K):
[in this window]
[in a new window]
 
FIG. 4.   Inhibition of p110alpha by dephosphorylated p85. (A) Forty-eight hours after infection with p85 baculovirus, Sf-9 cells were labeled with [32P]orthophosphate for 4 h. The cells were lysed, treated with recombinant protein phosphatase 1 (0.5 µg) or not treated, and immunoprecipitated with anti-p85-protein A-Sepharose beads. Proteins were eluted and separated by SDS-PAGE, and the dried gel was visualized by autoradiography and quantitated with a Molecular Dynamics PhosphorImager. (B) Lysates from Sf-9 cells expressing p85 were treated in the absence or presence of recombinant protein phosphatase 1 (0.5 µg). p85 was purified by absorption on anti-p85-protein A-Sepharose beads and mixed with p110alpha , and lipid kinase activity was determined. All determinations were made in triplicate, and the data are the means ± standard errors of the means of two separate experiments.

Activity of monomeric p110alpha in mammalian cells: requirement for p85 is supplanted by bulky N-terminal tags. In contrast with the data from insect cells, several laboratories have suggested that p110alpha expressed in mammalian cells is inactive as a monomer and requires binding to p85 for activity (11, 18). However, p110beta is highly active as a monomer in mammalian cells (13). Although the reason for these discrepancies has not been clear, we noted that the studies examining p110alpha used C-terminal epitope tags, whereas the study with p110beta used an N-terminal tag, a Tris-HA cassette inserted between residues 30 and 31.

We reexamined this question with HEK 293T cells by transiently expressing bovine p110alpha containing an epitope tag at either its N or C terminus. In agreement with previous reports, C-terminally myc-tagged p110alpha had little activity as a monomer, but its specific activity was increased nearly 20-fold by coexpression with p85 (Fig. 5A). Interestingly, placement of the myc tag at the N terminus of p110alpha increased its specific activity eightfold relative to the activity of C-myc-110. The specific activity of N-myc-p110alpha was increased approximately threefold more by coexpression with p85, i.e., to a level similar to that seen in cells transfected with C-myc-p110alpha and p85.


View larger version (21K):
[in this window]
[in a new window]
 
FIG. 5.   Activity of epitope-tagged p110alpha : comparison of N-terminal versus C-terminal tags. (A) HEK 293T cells were transfected with expression vectors for C-myc- or N-myc-p110alpha (30 µg) plus control vector or an expression vector for p85 (30 µg). Forty-eight hours after transfection the cells were lysed, and anti-myc immunoprecipitates were prepared. The immune complexes were assayed for lipid kinase activity. Parallel samples were eluted, separated by SDS-PAGE, and blotted sequentially with anti-p110alpha and anti-p85 antibodies. PI 3'-kinase specific activity was calculated relative to p110alpha expression, as measured by blotting. Data from different experiments were normalized to the activity of C-myc-p110alpha in each experiment. All determinations were performed in triplicate, and the data are the means ± standard errors of the means from five separate experiments. (B) HEK 293T cells were transfected with 30 (C-myc-p110alpha , N-myc-p110alpha , and GST-p110alpha ) or 45 µg (3HA-p110alpha ) of DNA. The cells were lysed after 48 h, and anti-myc, anti-HA, and anti-GST immunoprecipitates were prepared. Lipid and protein determinations and data normalization were performed as described for panel A. All determinations were performed in triplicate, and the data are the means ± standard errors of the means from four separate experiments.

We next compared the activities of p110alpha isoforms containing various N-terminal tags. p110alpha was modified by the addition of myc, Tris-HA, or GST tags as indicated and expressed in HEK 293T cells. As seen before, placement of the myc tag at the N terminus of p110alpha increased its activity by approximately eightfold relative to C-myc-p110alpha (Fig. 5B). However, an N-terminal Tris-HA cassette (38 amino acids) increased activity by 20-fold relative to C-myc-p110alpha , whereas an N-terminal GST tag increased activity by 45-fold (Fig. 5B). It should be noted that the expressed proteins were immunoprecipitated with different antitag antibodies, making it difficult to directly compare their expression levels. Nonetheless, the immunoprecipitates were assayed under identical conditions and were subjected to blotting with the same anti-p110 antibody. Thus, the determination of p110 specific activity was unaffected by potential differences in recovery during immunoprecipitation.

These data suggest that in mammalian cells, the attachment of a bulky N-terminal tag to the amino terminus of p110alpha can substitute for p85, which also binds to the N terminus of p110alpha . We therefore examined the effect of p85 on the C-myc-p110 and GST-p110 constructs. HEK 293T cells were transfected with C-myc-p110 and GST-p110 (30 and 5 µg of DNA, respectively) in the absence or presence of p85. Both constructs could associate with p85, as shown by anti-p85 immunoblotting of the anti-myc and anti-GST immunoprecipitates (Fig. 6A, bottom). When we measured the specific activities of C-myc-p110 and GST-p110, we found that the specific activity of C-myc-p110alpha in cells cotransfected with p85 was increased 13-fold relative to the activity of C-myc-p110alpha monomers (Fig. 6B). In contrast, the activity of GST-p110 was increased only twofold by coexpression with p85, relative to the activity of GST-p110 alone (Fig. 6B). Thus, p85 significantly increased the activity of C-myc-p110 but had only a small effect on GST-p110. These data suggest that both p85 and the GST N-terminal tag increase the specific activity of p110alpha by a similar mechanism. This mechanism is unlikely to involve a specific activating protein-protein interaction and is more likely to reflect a stabilization of the overall conformation of p110alpha . Although GST-p110 is already much more active than C-myc-p110, the ability of p85 to increase its activity by an additional two times suggests that it is still not maximally stabilized. The effect of p85 on an additionally stabilized GST-p110 is examined below.


View larger version (27K):
[in this window]
[in a new window]
 
FIG. 6.   Effect of p85 on C-myc-p110alpha versus GST-p110alpha . HEK 293T cells were transfected with expression vectors for C-myc p110alpha or GST-p110alpha in the presence of a control vector or the expression vector for p85. (A) Anti-myc or anti-GST immunoprecipitates (IP) were blotted with anti-p110 antibody (top lanes) or anti-p85 antibody (lower lanes). (B) Protein and lipid kinase activities in anti-myc or anti-GST immunoprecipitates were calculated as described in the legend for Fig. 5A. The data are expressed as the fold stimulation for each construct in the presence versus the absence of p85. All determinations were performed in triplicate, and the data are the means ± standard errors of the means from two separate experiments.

To directly test whether p85 stabilizes p110alpha in mammalian cells, we examined the effect of p85 on the half-life of p110alpha in metabolically labeled cells. HEK 293T cells were transfected with C-myc-p110alpha in the absence or presence of p85 and labeled with [35S]methionine for 16 h. The cells were then chased in medium containing cold methionine for the indicated times, and C-myc-p110alpha was immunoprecipitated with anti-myc antibodies (Fig. 7). In the absence of p85, C-myc-p110alpha turned over with a half-life of approximately 1 h and was completely gone by 5 h. In contrast, C-myc-p110alpha /p85 dimers were significantly more stable, with an approximate half-life of 5 h. We also found that the half-life of GST-p110 in [35S]methionine-labeled cells was significantly greater than that of C-myc-p110 (data not shown). Thus, p110alpha was stabilized by dimerization with p85 or linkage to a bulky N-terminal tag.


View larger version (41K):
[in this window]
[in a new window]
 
FIG. 7.   Stabilization of p110 by p85 in mammalian cells. HEK 293T cells were transfected with vectors for C-myc-p110 in the absence or presence of p85. Thirty-six hours after transfection the cells were labeled with [35S]methionine overnight and then chased for the indicated times in medium containing 10× methionine. The cells were lysed, and immunoprecipitated p110 was separated by SDS-PAGE and visualized by autoradiography. The data are representative of two separate experiments.

Monomeric p110alpha is temperature sensitive in mammalian cells. While these data suggest that the rescue of monomeric p110alpha activity by p85 in mammalian cells reflects a stabilization of the catalytic subunit, they do not explain why this is not observed when the proteins are expressed in insect cells. We noted that a major difference between mammalian and insect culture systems is the low temperature (27°C) used for Sf-9 cells and reasoned that this might affect the stability of a conformationally labile p110alpha monomer. We therefore compared the activities of C-myc-p110alpha monomers in HEK 293T cells grown at 37 versus 30°C. Strikingly, the specific activity of C-myc-p110alpha in HEK 293T cells was increased 15-fold by culture at 30°C (Fig. 8A), consistent with idea that monomeric p110alpha is conformationally unstable.


View larger version (20K):
[in this window]
[in a new window]
 
FIG. 8.   Effect of temperature on the activity of p110alpha . (A) HEK 293T cells were transfected with expression vectors for C-myc-p110alpha and then maintained for 48 h at 37 or 30°C. The cells were then lysed, and protein expression and lipid kinase activities were determined as described in the legend for Fig. 5A. All determinations were performed in triplicate, and the data are the means ± standard errors of the means (SEM) from two experiments. (B) Recombinant p110 or p85/p110 dimers were incubated at the indicated temperatures for 30 min. After being chilled on ice, the samples were assayed for lipid kinase activity at 22°C. The data are the means ± SEM from three separate experiments.

The effect of p85 on thermal stability was examined in vitro by producing p110alpha monomers and p85/p110alpha dimers in Sf-9 cells and then incubating them for 30 min at various temperatures prior to assay at 22°C (Fig. 8B). In the absence of p85, p110alpha was strikingly sensitive to elevated temperatures and lost half its activity after 30 min at 35°C. In contrast, the activity of p85/p110alpha was minimally affected until temperatures reached 40°C or higher. These data confirm the hypothesis that monomeric p110 is thermally unstable and suggest that p85 increases the activity of p110alpha in mammalian cells by stabilizing the catalytic subunit.

Inhibition of p110alpha by p85 in mammalian cells. To further reconcile the data derived from the insect and mammalian systems, we sought to determine whether p85 acts as an inhibitor of p110alpha in mammalian cells. To do this, it was necessary to experimentally segregate the stabilizing effects of p85 from its potential inhibitory effects. We therefore measured the activities of p110alpha and p85/p110alpha under conditions designed to maximize the stability of the p110alpha monomer. We transfected HEK 293T cells with the GST-p110alpha cDNA in the presence of empty vector or p85 expression plasmid, and cultured the cells at 30°C. p85 immunoblots of anti-GST immunoprecipitates demonstrated that p85 associated with GST-p110alpha in cells grown at 30°C (data not shown). Interestingly, coexpression of p85 with GST-p110 in HEK 293T cells caused a 50% decrease in the specific activity of GST-p110, compared with the activity of GST-p110 alone (Fig. 9). This result is similar to the data obtained with recombinant baculovirus p110alpha (Fig. 1 and 2). These data show that under conditions that optimize the stability of monomeric p110alpha in mammalian cells, p85 inhibits p110alpha in a manner similar to that seen in insect cells.


View larger version (16K):
[in this window]
[in a new window]
 
FIG. 9.   Inhibition of p110 by p85 in mammalian cells. HEK 293T cells were transfected with GST-p110alpha in the presence of control vector or p85 expression vector as indicated. After 48 h at 30°C, the cells were lysed and protein and lipid kinase activities were determined. The activities were normalized to the activity of GST-p110alpha . All determinations were performed in triplicate, and the data are representative of four separate experiments.

    DISCUSSION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

Our data show that p85 has two distinct effects on the activity of p110alpha . On the one hand, p85 binds to the N terminus of p110alpha and inhibits the activity of the p110alpha monomer. This effect is clearly seen under experimental conditions in which monomeric p110 is stable. On the other hand, p85 stabilizes p110alpha . This effect is most clearly seen in mammalian cells at 37°C, a temperature at which monomeric p110alpha is unstable. The net activity of p110alpha in a given experimental protocol reflects a balance between the inhibitory and stabilizing effects of p85 on p110alpha .

With regard to the inhibitory effect, we show that the p85 regulatory subunit of PI 3'-kinase decreases the activity of the p110alpha catalytic subunit produced in Sf-9 cells. Given that the binding of p85 to p110alpha is extremely stable (45), the basal state of a p85/p110alpha dimer is inhibited relative to the activity of monomeric p110alpha . This inhibition appears to be a direct result of dimerization with p85, since it can be readily reconstituted in vitro and in fact can be seen with p85 expressed in bacteria (data not shown). Similarly, we find that inhibition of p110alpha by p85 is unaffected by mutation of the Ser-608 inhibitory site of p85 or by dephosphorylation of p85 with protein phosphatase 1. We have no information as to the level of Ser-608 phosphorylation in p85 produced in Sf-9 cells and can make no comment on potential additional roles for Ser-608 in the regulation of p110alpha activity. However, the inhibition we record here is clearly independent of p85 phosphorylation. Our results differ from those of Woscholski et al., who reported that coexpression of p85 with p110 induced a phosphorylation-dependent 17-fold increase in the Km for ATP (45). This increase was only seen by using PI[4,5]P2 as a lipid substrate and was not seen when p85 was reconstituted with p110alpha in vitro. These data may reflect a different phenomenon than the one described in the present study, since the inhibition we observe is clearly seen with PI, PI[4]P, or PI[4,5]P2 and does not require the coexpression of the two subunits.

We and others have previously shown that the activity of p85/p110alpha dimers is increased when the SH2 domains of p85 bind to phosphotyrosyl proteins containing appropriate sequence motifs (2, 5). This increase presumably reflects a conformational change induced by phosphopeptide binding, since p85 remains bound to p110 in the presence of phosphotyrosyl proteins (2). Our current data suggest that the increased activity of p85/p110alpha heterodimers when bound to phosphoproteins such as IRS-1 is not a true activation of p110alpha , but rather a disinhibition of the p85/p110alpha heterodimer. Thus, activation of p85/p110alpha dimers in mitogen-stimulated cells reflects a transition between inhibited and disinhibited states. Using recombinant enzyme and varying the concentration of either lipid or ATP, we find that relative Vmax/Km values for p85/p110alpha dimers are decreased by 60 to 85% compared to that seen with monomeric p110alpha . The relative Vmax/Km values for p85/p110alpha dimers are increased by incubation with bisphosphorylated peptide, to within 75 to 95% of that seen with monomeric p110alpha . However, the activity of "activated" p85/p110alpha dimers never exceeds that of an equivalent amount of monomeric p110alpha .

It is interesting to note that while inhibition of p110alpha by p85 was seen by using PI, PI[4]P, or PI[4,5]P2 as the substrate, the subsequent activation of the p85/p110alpha dimers by phosphopeptides was less effective with PI[4,5]P2 as a substrate than with the other lipids. In this regard, Rameh and coworkers have noted that PI[3,4,5]P3 binds to the p85 SH2 domains and can compete with tyrosyl-phosphorylated IRS-1 for p85 binding (30). Thus, it is possible that the in vitro-produced PI[3,4,5]P3 competes with phosphopeptide for SH2 domain occupancy, reducing the resultant activation of p85/p110alpha dimers.

In contrast to our data obtained with recombinant enzyme produced in Sf-9 cells, previous studies have shown that the activity of p110alpha is significantly increased when the isoform is coexpressed with p85 in mammalian cells (18), and attachment of the iSH2 domain to p110 has been used to produce a constitutively active enzyme (15). How can one reconcile this apparent activation of p110 by p85 in mammalian cells with the inhibition we observe in Sf-9 cells?

The explanation suggested by our data is that p110alpha is unstable as a monomer at 37°C but can be stabilized by the binding of p85 to its N terminus. Although the binding of p85 to p110alpha requires specific interactions between the iSH2 domain of p85 and the N terminus of p110alpha (12, 14, 19), the stabilization of p110alpha by p85 appears to be relatively nonspecific. It can be replaced by either synthesis at low temperature or the attachment of a bulky N-terminal tag. The ability of these nonspecific interventions to mimic the effects of p85 suggest that the regulatory subunit acts by stabilizing the overall conformation of the catalytic subunit, rather than by inducing a specific activated conformation in p110alpha . This is supported by the increased half-life of p85/p110alpha dimers as opposed to p110alpha monomers in mammalian cells and by the finding that p85 protects p110alpha from thermal inactivation. Thus, the apparent activation of p110alpha by p85 in mammalian cells at 37°C does not reflect the difference between an enzyme in its basal and activated states. Instead, it reflects the difference between a nonfunctional, destabilized enzyme and an enzyme in its basal state.

Of the two effects of p85 on the activity of p110alpha , the stabilizing effects are predominant when the activities of p110 monomers and p85/p110 heterodimers in mammalian cells at 37°C are compared (a 15- to 20-fold difference). However, the stabilizing effects of p85 are less impressive when the activity of monomeric GST-p110 is compared to that of p85/GST-p110 in mammalian cells (a twofold difference). When GST-p110 is further stabilized by growth of the cells at 30°C, we find that the p110alpha catalytic subunit is maximally active as a monomer and is inhibited 50% by dimerization with the p85 regulatory subunit. This degree of inhibition is somewhat less than the 80% inhibition we see with p110alpha from insect cells. The lesser degree of inhibition could be due to interactions between p85 and additional regulatory molecules present in HEK 293T cells. Alternatively, although the conditions were designed to experimentally segregate the stabilizing and inhibitory effects of p85, it is likely that p85 is still somewhat stabilizing, even in mammalian cells at 30°C. This is consistent with the finding that monomeric p110alpha loses activity after 30 min at 30°C in vitro. Attempts to culture HEK 293T cells at lower temperatures were unsuccessful. Nonetheless, our data show that p85 has qualitatively similar effects on p110alpha in mammalian and insect cells under conditions that augment the stability of the p110alpha monomer.

Our data are not inconsistent with the data presented by Klippel et al. and Hu et al., who showed that the activity of C-myc-tagged p110alpha was rescued by either coexpression with the iSH2 domain of p85 or direct linkage of the iSH2 domain to the N terminus of p110alpha (15, 18). The iSH2 domain of p85 presumably stabilizes monomeric p110alpha in much the same way as p85, leading to an apparent activation in mammalian cells at 37°C. The iSH2 domain does not, however, appear to be a p110alpha activator, since binding of the recombinant iSH2 domain to recombinant p110alpha in vitro has no effect on p110alpha activity (46a). Similarly, the effects of a tethered iSH2 domain are mimicked by a tethered GST moiety, suggesting that conformational stability rather than specific activating interactions are involved.

In intact cells, the activity of p85/p110alpha dimers may also be affected by their binding to GTP-bound ras and CDC42, SH3 domains from Src family kinases, or proline-rich proteins that bind to the p85 SH3 domain (10, 28, 32, 47). It is not yet clear whether these mechanisms of activation are distinct from activation via phosphotyrosine-SH2 domain binding and whether they would lead to levels of activity above that seen with monomeric p110alpha . Thus, it is possible that activation of p85/p110alpha above the level of monomeric p110alpha occurs in the more complex environment of the intact cell. Moreover, an additional contribution to intracellular 3-phosphoinositide production would come from the targeting of p85/p110alpha to cell membranes. The ability of the p85 regulatory subunit to modulate p110alpha activity in response to these disparate inputs will be of great mechanistic interest for further studies.

    ACKNOWLEDGMENTS

We thank Zhong-Yin Zhang and Steve Almo for numerous helpful discussions. We thank Michael Waterfield for the p110alpha cDNA and Zhong-Yin Zhang for the recombinant PP1.

This work was supported by grants to J.M.B. from the American Diabetes Association and National Institutes of Health grant GM55692. J.M.B. is an Established Scientist of the American Heart Association, New York Affiliate, and is a recipient of a Scholar Award from the Irma T. Hirschl Trust. J.M. was supported by a fellowship from the Juvenile Diabetes Foundation.

    FOOTNOTES

* Corresponding author. Mailing address: Department of Molecular Pharmacology, Albert Einstein College of Medicine, 1300 Morris Park Ave., Bronx, NY 10461. Phone: (718) 430-2153. Fax: (718) 430-8922. E-mail: Backer{at}AECOM.yu.edu.

    REFERENCES
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

1. Antonetti, D. A., P. Algenstaedt, and C. R. Kahn. 1996. Insulin receptor substrate 1 binds two novel splice variants of the regulatory subunit of phosphatidylinositol 3-kinase in muscle and brain. Mol. Cell. Biol. 16:2195-2203[Abstract].
2. Backer, J. M., Jr., M. G. Myers, S. E. Shoelson, D. J. Chin, X. J. Sun, M. Miralpeix, P. Hu, B. Margolis, E. Y. Skolnik, J. Schlessinger, and M. F. White. 1992. The phosphatidylinositol 3'-kinase is activated by association with IRS-1 during insulin stimulation. EMBO J. 11:3469-3479[Medline].
3. Booker, G. W., I. Gout, A. K. Downing, P. C. Driscoll, J. Boyd, M. D. Waterfield, and I. D. Campbell. 1993. Solution structure and ligand-binding site of the SH3 domain of the p85alpha subunit of phosphatidylinositol 3-kinase. Cell 73:813-822[Medline].
4. Cantley, L. C., K. R. Auger, C. Carpenter, B. Duckworth, A. Graziani, R. Kapeller, and S. Soltoff. 1991. Oncogenes and signal transduction. Cell 64:231-302.
5. Carpenter, C. L., K. R. Auger, M. Chanudhuri, M. Yoakim, B. Schaffhausen, S. Shoelson, and L. C. Cantley. 1993. Phosphoinositide 3-kinase is activated by phosphopeptides that bind to the SH2 domains of the 85-kDa subunit. J. Biol. Chem. 268:9478-9483[Abstract/Free Full Text].
6. Cheatham, B., C. J. Vlahos, L. Cheatham, L. Wang, J. Blenis, and C. R. Kahn. 1994. Phosphatidylinositol 3-kinase activation is required for insulin stimulation of pp70 S6 kinase, DNA synthesis, and glucose transporter translocation. Mol. Cell. Biol. 14:4902-4911[Abstract/Free Full Text].
7. Dhand, R., K. Hara, I. Hiles, B. Bax, I. Gout, G. Panayotou, M. J. Fry, K. Yonezawa, M. Kasuga, and M. D. Waterfield. 1994. PI 3-kinase: structural and functional analysis of intersubunit interactions. EMBO J. 13:511-521[Medline].
8. Dhand, R., I. Hiles, G. Panayotou, S. Roche, M. J. Fry, I. Gout, N. F. Totty, O. Truong, P. Vicendo, K. Yonezawa, M. Kasuga, S. A. Courtneidge, and M. D. Waterfield. 1994. PI 3-kinase is a dual specificity enzyme: autoregulation by an intrinsic protein-serine kinase activity. EMBO J. 13:522-533[Medline].
9. Escobedo, J. A., S. Navankasattusas, W. M. Kavanaugh, D. Milfay, V. A. Fried, and L. T. Williams. 1991. cDNA cloning of a novel 85 kD protein that has SH2 domains and regulates binding of PI3-kinase to the PDGF beta -receptor. Cell 65:75-82[Medline].
10. Guinebault, C., B. Payrastre, C. Racaud-Sultan, H. Mazarguil, M. Breton, G. Mauco, M. Plantavid, and H. Chap. 1995. Integrin-dependent translocation of phosphoinositide 3-kinase to the cytoskeleton of thrombin-activated platelets involves specific interactions of p85-alpha with actin filaments and focal adhesion kinase. J. Cell Biol. 129:831-842[Abstract/Free Full Text].
11. Hiles, I. D., M. Otsu, S. Volinia, M. J. Fry, I. Gout, R. Dhand, G. Panayotou, F. Ruiz-Larrea, A. Thompson, N. F. Totty, J. J. Hsuan, S. A. Courtneidge, P. J. Parker, and M. D. Waterfield. 1992. Phosphatidylinositol 3-kinase: structure and expression of the 110 kd catalytic subunit. Cell 70:419-429[Medline].
12. Holt, K. H., A. L. Olson, W. S. Moye-Rowley, and J. E. Pessin. 1994. Phosphatidylinositol 3-kinase activation is mediated by high-affinity interactions between distinct domains within the p110 and p85 subunits. Mol. Cell. Biol. 14:42-49[Abstract/Free Full Text].
13. Hu, P., A. Mondino, E. Y. Skolnik, and J. Schlessinger. 1993. Cloning of a novel, ubiquitously expressed human phosphatidylinositol 3-kinase and identification of its binding site on p85. Mol. Cell. Biol. 13:7677-7688[Abstract/Free Full Text].
14. Hu, P., and J. Schlessinger. 1994. Direct association of p110beta phosphatidylinositol 3-kinase with p85 is mediated by an N-terminal fragment of p110beta . Mol. Cell. Biol. 14:2577-2583[Abstract/Free Full Text].
15. Hu, Q., A. Klippel, A. J. Muslin, W. J. Fantl, and L. T. Williams. 1995. Ras-dependent induction of cellular responses by constitutively active phosphatidylinositol-3 kinase. Science 268:100-102[Abstract/Free Full Text].
16. Joly, M., A. Kazlauskas, and S. Corvera. 1995. Phosphatidylinositol 3-kinase activity is required at a postendocytic step in platelet-derived growth factor receptor trafficking. J. Biol. Chem. 270:13225-13230[Abstract/Free Full Text].
17. Kapeller, R., K. V. S. Prasad, O. Janssen, W. Hou, B. S. Schaffhausen, C. E. Rudd, and L. C. Cantley. 1994. Identification of two SH3-binding motifs in the regulatory subunit of phosphatidylinositol 3-kinase. J. Biol. Chem. 269:1927-1933[Abstract/Free Full Text].
18. Klippel, A., J. A. Escobedo, M. Hirano, and L. T. Williams. 1994. The interaction of small domains between the subunits of phosphatidylinositol 3-kinase determines enzyme activity. Mol. Cell. Biol. 14:2675-2685[Abstract/Free Full Text].
19. Klippel, A., J. A. Escobedo, Q. Hu, and L. T. Williams. 1993. A region of the 85-kilodalton (kDa) subunit of phosphatidylinositol 3-kinase binds the 110-kDa catalytic subunit in vivo. Mol. Cell. Biol. 13:5560-5566[Abstract/Free Full Text].
20. Kotani, K., K. Yonezawa, K. Hara, H. Ueda, Y. Kitamura, H. Sakaue, A. Ando, A. Chavanieu, B. Calas, F. Grigorescu, M. Nishiyama, M. D. Waterfield, and M. Kasuga. 1994. Involvement of phosphoinositide 3-kinase in insulin- or IGF-1-induced membrane ruffling. EMBO J. 13:2313-2321[Medline].
21. Kozak, M. 1986. Point mutations define a sequence flanking the AUG initiator codon that modulates translation by eukaryotic ribosomes. Cell 44:283-292[Medline].
22. Kozak, M. 1997. Recognition of AUG and alternative initiator codons is augmented by G in position +4 but is not generally affected by the nucleotides in positions +5 and +6. EMBO J. 16:2482-2492[Medline].
23. Kunkel, T. A., J. D. Roberts, and R. A. Zakour. 1987. Rapid and efficient site-specific mutagenesis without phenotypic selection. Methods Enzymol. 154:367-382[Medline].
24. Leevers, S. J., D. Weinkove, L. K. MacDougall, E. Hafen, and M. D. Waterfield. 1996. The Drosophila phosphoinositide 3-kinase Dp110 promotes cell growth. EMBO J. 15:6584-6594[Medline].
25. McIlroy, J., D. Chen, C. Wjasow, T. Michaeli, and J. M. Backer. 1997. Specific activation of p85-p110 phosphatidylinositol 3'-kinase stimulates DNA synthesis by ras- and p70 S6 kinase-dependent pathways. Mol. Cell. Biol. 17:248-255[Abstract].
26. Molz, L., Y. W. Chen, M. Hirano, and L. T. Williams. 1996. Cpk is a novel class of Drosophila PtdIns 3-kinase containing a C2 domain. J. Biol. Chem. 271:13892-13899[Abstract/Free Full Text].
27. Otsu, M., I. Hiles, I. Gout, M. J. Fry, F. Ruiz-Larrea, G. Panayotou, A. Thompson, R. Dhand, J. Hsuan, N. Totty, A. D. Smith, S. J. Morgan, S. A. Courtneidge, P. J. Parker, and M. D. Waterfield. 1991. Characterization of two 85 kD proteins that associate with receptor tyrosine kinases, middle-T/pp60c-src complexes and PI3-kinase. Cell 65:91-104[Medline].
28. Pleiman, C. M., W. M. Hertz, and J. C. Cambier. 1994. Activation of phosphatidylinositol-3' kinase by Src-family kinase SH3 binding to the p85 subunit. Science 263:1609-1612[Abstract/Free Full Text].
29. Pons, S., T. Asano, E. Glasheen, M. Miralpeix, Y. Zhang, T. L. Fisher, M. G. Myers, Jr., X. J. Sun, and M. F. White. 1995. The structure and function of p55PIK reveal a new regulatory subunit for phosphatidylinositol 3-kinase. Mol. Cell. Biol. 15:4453-4465[Abstract].
30. Rameh, L. E., C.-S. Chen, and L. C. Cantley. 1995. Phosphatidylinositol (3,4,5)P3 interacts with SH2 domains and modulates PI 3-kinase association with tyrosine-phosphorylated proteins. Cell 83:821-830[Medline].
31. Roche, S., M. Koegl, and S. A. Courtneidge. 1994. The phosphatidylinositol 3-kinase alpha  is required for DNA synthesis induced by some, but not all, growth factors. Proc. Natl. Acad. Sci. USA 91:9185-9189[Abstract/Free Full Text].
32. Rodriguez-Viciana, P., P. H. Warne, B. Vanhaesebroeck, M. D. Waterfield, and J. Downward. 1996. Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation. EMBO J. 15:2442-2451[Medline].
33. Rordorf-Nikolic, T., D. J. Van Horn, D. Chen, M. F. White, and J. M. Backer. 1995. Regulation of phosphatidylinositol 3'-kinase by tyrosyl phosphoproteins. Full activation requires occupancy of both SH2 domains in the 85-kDa regulatory subunit. J. Biol. Chem. 270:3662-3666[Abstract/Free Full Text].
34. Ruderman, N., R. Kapeller, M. F. White, and L. C. Cantley. 1990. Activation of phosphatidylinositol-3-kinase by insulin. Proc. Natl. Acad. Sci. USA 87:1411-1415[Abstract/Free Full Text].
35. Schu, P. V., K. Takegawa, M. J. Fry, J. H. Stack, M. D. Waterfield, and S. D. Emr. 1993. Phosphatidylinositol 3-kinase encoded by yeast VPS34 gene essential for protein sorting. Science 260:88-91[Abstract/Free Full Text].
36. Skolnik, E. Y., B. Margolis, M. Mohammadi, E. Lowenstein, R. Fischer, A. Drepps, A. Ullrich, and J. Schlessinger. 1991. Cloning of PI3 kinase-associated p85 utilizing a novel method for expression/cloning of target proteins for receptor tyrosine kinases. Cell 65:83-90[Medline].
37. Songyang, Z., S. E. Shoelson, M. Chaudhuri, G. Gish, T. Pawson, W. G. Haser, F. King, T. Roberts, S. Ratnofsky, R. J. Lechleider, B. G. Neel, R. B. Birge, J. E. Fajardo, M. M. Chou, H. Hanafusa, B. Schaffhausen, and L. C. Cantley. 1993. SH2 domains recognize specific phosphopeptide sequences. Cell 72:767-778[Medline].
38. Stephens, L. R., A. Eguinoa, H. Erdjument-Bromage, M. Lui, F. Cooke, J. Coadwell, A. S. Smrcka, M. Thelen, K. Cadwallader, P. Tempst, and P. T. Hawkins. 1997. The Gbeta gamma sensitivity of a PI3K is dependent upon a tightly associated adaptor, p101. Cell 89:105-114[Medline].
39. Stoyanov, B., S. Volinia, T. Hanck, I. Rubio, M. Loubtchenkov, D. Malek, S. Stoyanova, B. Vanhaesebroeck, R. Dhand, B. Nurnberg, P. Gierschik, K. Seedorf, J. J. Hsuan, M. D. Waterfield, and R. Wetzker. 1995. Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase. Science 269:690-693[Abstract/Free Full Text].
40. Sun, X. J., P. Rothenberg, C. R. Kahn, J. M. Backer, E. Araki, P. A. Wilden, D. A. Cahill, B. J. Goldstein, and M. F. White. 1991. The structure of the insulin receptor substrate IRS-1 defines a unique signal transduction protein. Nature 352:73-77[Medline].
41. Tolias, K. F., L. C. Cantley, and C. L. Carpenter. 1995. Rho family GTPases bind to phosphoinositide kinases. J. Biol. Chem. 270:17656-17659[Abstract/Free Full Text].
42. Vanhaesebroeck, B., M. J. Welham, K. Kotani, R. Stein, P. H. Warne, M. J. Zvelebil, K. Higashi, S. Volinia, J. Downward, and M. D. Waterfield. 1997. p110-delta, a novel phosphoinositide 3-kinase in leukocytes. Proc. Natl. Acad. Sci. USA 94:4330-4335[Abstract/Free Full Text].
43. Virbasius, J. V., A. Guilherme, and M. P. Czech. 1996. Mouse p170 is a novel phosphatidylinositol 3-kinase containing a C2 domain. J. Biol. Chem. 271:13304-13307[Abstract/Free Full Text].
44. Volinia, S., R. Dhand, B. Vanhaesebroeck, L. K. MacDougall, R. Stein, M. J. Zvelebil, J. Domin, C. Panaretou, and M. D. Waterfield. 1995. A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system. EMBO J. 14:3339-3348[Medline].
45. Woscholski, R., R. Dhand, M. J. Fry, M. D. Waterfield, and P. J. Parker. 1994. Biochemical characterization of the free catalytic p110alpha and the complexed heterodimeric p110alpha · p85alpha forms of the mammalian phosphatidylinositol 3-kinase. J. Biol. Chem. 269:25067-25072[Abstract/Free Full Text].
46. Yao, R., and G. M. Cooper. 1995. Requirement for phosphatidylinositol-3 kinase in the prevention of apoptosis by nerve growth factor. Science 267:2003-2006[Abstract/Free Full Text].
46a. Yu, J., and J. M. Backer. Unpublished data.
47. Zheng, Y., S. Bagrodia, and R. A. Cerione. 1994. Activation of phosphoinositide 3-kinase by Cdc42Hs binding to p85. J. Biol. Chem. 269:18727-18730[Abstract/Free Full Text].
48. Zvelebil, M. J., L. MacDougall, S. Leevers, S. Volinia, B. Vanhaesebroeck, I. Gout, G. Panayotou, J. Domin, R. Stein, F. Pages, F. Hoga, K. Salim, J. Linacre, P. Das, C. Panaretou, R. Wetzker, and M. Waterfield. 1996. Structural and functional diversity of phosphoinositide 3-kinases. Philos. Trans. R. Soc. Lond. 351:217-223[Medline].


Mol Cell Biol, March 1998, p. 1379-1387, Vol. 18, No. 3
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.



This article has been cited by other articles:

  • Xie, D., Gore, C., Zhou, J., Pong, R.-C., Zhang, H., Yu, L., Vessella, R. L., Min, W., Hsieh, J.-T. (2009). DAB2IP coordinates both PI3K-Akt and ASK1 pathways for cell survival and apoptosis. Proc. Natl. Acad. Sci. USA 106: 19878-19883 [Abstract] [Full Text]  
  • Adhikari, D., Liu, K. (2009). Molecular Mechanisms Underlying the Activation of Mammalian Primordial Follicles. Endocr. Rev. 30: 438-464 [Abstract] [Full Text]  
  • Martin-Fernandez, C., Bales, J., Hodgkinson, C., Welman, A., Welham, M. J., Dive, C., Morrow, C. J. (2009). Blocking Phosphoinositide 3-Kinase Activity in Colorectal Cancer Cells Reduces Proliferation but Does Not Increase Apoptosis Alone or in Combination with Cytotoxic Drugs. Mol Cancer Res 7: 955-965 [Abstract] [Full Text]  
  • Alcazar, I., Cortes, I., Zaballos, A., Hernandez, C., Fruman, D. A., Barber, D. F., Carrera, A. C. (2009). p85{beta} phosphoinositide 3-kinase regulates CD28 coreceptor function. Blood 113: 3198-3208 [Abstract] [Full Text]  
  • Rigor, D. L., Bodyak, N., Bae, S., Choi, J. H., Zhang, L., Ter-Ovanesyan, D., He, Z., McMullen, J. R., Shioi, T., Izumo, S., King, G. L., Kang, P. M. (2009). Phosphoinositide 3-kinase Akt signaling pathway interacts with protein kinase C{beta}2 in the regulation of physiologic developmental hypertrophy and heart function. Am. J. Physiol. Heart Circ. Physiol. 296: H566-H572 [Abstract] [Full Text]  
  • Boulay, P.-L., Cotton, M., Melancon, P., Claing, A. (2008). ADP-ribosylation Factor 1 Controls the Activation of the Phosphatidylinositol 3-Kinase Pathway to Regulate Epidermal Growth Factor-dependent Growth and Migration of Breast Cancer Cells. J. Biol. Chem. 283: 36425-36434 [Abstract] [Full Text]  
  • Serra, V., Markman, B., Scaltriti, M., Eichhorn, P. J.A., Valero, V., Guzman, M., Botero, M. L., Llonch, E., Atzori, F., Di Cosimo, S., Maira, M., Garcia-Echeverria, C., Parra, J. L., Arribas, J., Baselga, J. (2008). NVP-BEZ235, a Dual PI3K/mTOR Inhibitor, Prevents PI3K Signaling and Inhibits the Growth of Cancer Cells with Activating PI3K Mutations. Cancer Res. 68: 8022-8030 [Abstract] [Full Text]  
  • Li, Y., Anderson, D. H., Liu, Q., Zhou, Y. (2008). Mechanism of Influenza A Virus NS1 Protein Interaction with the p85{beta}, but Not the p85{alpha}, Subunit of Phosphatidylinositol 3-Kinase (PI3K) and Up-regulation of PI3K Activity. J. Biol. Chem. 283: 23397-23409 [Abstract] [Full Text]  
  • Fos, C., Salles, A., Lang, V., Carrette, F., Audebert, S., Pastor, S., Ghiotto, M., Olive, D., Bismuth, G., Nunes, J. A. (2008). ICOS Ligation Recruits the p50{alpha} PI3K Regulatory Subunit to the Immunological Synapse. J. Immunol. 181: 1969-1977 [Abstract] [Full Text]  
  • Yuan, T. L., Choi, H. S., Matsui, A., Benes, C., Lifshits, E., Luo, J., Frangioni, J. V., Cantley, L. C. (2008). Class 1A PI3K regulates vessel integrity during development and tumorigenesis. Proc. Natl. Acad. Sci. USA 105: 9739-9744 [Abstract] [Full Text]  
  • Zhao, L., Vogt, P. K. (2008). Helical domain and kinase domain mutations in p110{alpha} of phosphatidylinositol 3-kinase induce gain of function by different mechanisms. Proc. Natl. Acad. Sci. USA 105: 2652-2657 [Abstract] [Full Text]  
  • Hale, B. G., Batty, I. H., Downes, C. P., Randall, R. E. (2008). Binding of Influenza A Virus NS1 Protein to the Inter-SH2 Domain of p85 Suggests a Novel Mechanism for Phosphoinositide 3-Kinase Activation. J. Biol. Chem. 283: 1372-1380 [Abstract] [Full Text]  
  • Janas, M. L., Hodson, D., Stamataki, Z., Hill, S., Welch, K., Gambardella, L., Trotman, L. C., Pandolfi, P. P., Vigorito, E., Turner, M. (2008). The Effect of Deleting p110{delta} on the Phenotype and Function of PTEN-Deficient B Cells. J. Immunol. 180: 739-746 [Abstract] [Full Text]  
  • Masia, S., Alvarez, S., de Lera, A. R., Barettino, D. (2007). Rapid, Nongenomic Actions of Retinoic Acid on Phosphatidylinositol-3-Kinase Signaling Pathway Mediated by the Retinoic Acid Receptor. Mol. Endocrinol. 21: 2391-2402 [Abstract] [Full Text]  
  • Yip, S.-C., El-Sibai, M., Coniglio, S. J., Mouneimne, G., Eddy, R. J., Drees, B. E., Neilsen, P. O., Goswami, S., Symons, M., Condeelis, J. S., Backer, J. M. (2007). The distinct roles of Ras and Rac in PI 3-kinase-dependent protrusion during EGF-stimulated cell migration. J. Cell Sci. 120: 3138-3146 [Abstract] [Full Text]  
  • Hirsch, E., Costa, C., Ciraolo, E. (2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. J Endocrinol 194: 243-256 [Abstract] [Full Text]  
  • Miled, N., Yan, Y., Hon, W.-C., Perisic, O., Zvelebil, M., Inbar, Y., Schneidman-Duhovny, D., Wolfson, H. J., Backer, J. M., Williams, R. L. (2007). Mechanism of Two Classes of Cancer Mutations in the Phosphoinositide 3-Kinase Catalytic Subunit. Science 317: 239-242 [Abstract] [Full Text]  
  • Younes, H., Leleu, X., Hatjiharissi, E., Moreau, A.-S., Hideshima, T., Richardson, P., Anderson, K. C., Ghobrial, I. M. (2007). Targeting the Phosphatidylinositol 3-Kinase Pathway in Multiple Myeloma. Clin. Cancer Res. 13: 3771-3775 [Abstract] [Full Text]  
  • Walker, V. G., Ammer, A., Cao, Z., Clump, A. C., Jiang, B.-H., Kelley, L. C., Weed, S. A., Zot, H., Flynn, D. C. (2007). PI3K activation is required for PMA-directed activation of cSrc by AFAP-110. Am. J. Physiol. Cell Physiol. 293: C119-C132 [Abstract] [Full Text]  
  • Geering, B., Cutillas, P. R., Nock, G., Gharbi, S. I., Vanhaesebroeck, B. (2007). Class IA phosphoinositide 3-kinases are obligate p85-p110 heterodimers. Proc. Natl. Acad. Sci. USA 104: 7809-7814 [Abstract] [Full Text]  
  • Deane, J. A., Kharas, M. G., Oak, J. S., Stiles, L. N., Luo, J., Moore, T. I., Ji, H., Rommel, C., Cantley, L. C., Lane, T. E., Fruman, D. A. (2007). T-cell function is partially maintained in the absence of class IA phosphoinositide 3-kinase signaling. Blood 109: 2894-2902 [Abstract] [Full Text]  
  • Taniguchi, C. M., Tran, T. T., Kondo, T., Luo, J., Ueki, K., Cantley, L. C., Kahn, C. R. (2006). Phosphoinositide 3-kinase regulatory subunit p85{alpha} suppresses insulin action via positive regulation of PTEN. Proc. Natl. Acad. Sci. USA 103: 12093-12097 [Abstract] [Full Text]  
  • Riley, J. K, Moley, K. H (2006). Glucose utilization and the PI3-K pathway: mechanisms for cell survival in preimplantation embryos.. Reproduction 131: 823-835 [Abstract] [Full Text]  
  • Hazeki, K., Kinoshita, S., Matsumura, T., Nigorikawa, K., Kubo, H., Hazeki, O. (2006). Opposite Effects of Wortmannin and 2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one Hydrochloride on Toll-Like Receptor-Mediated Nitric Oxide Production: Negative Regulation of Nuclear Factor-{kappa}B by Phosphoinositide 3-Kinase. Mol. Pharmacol. 69: 1717-1724 [Abstract] [Full Text]  
  • Peloponese, J.-M. Jr., Jeang, K.-T. (2006). Role for Akt/Protein Kinase B and Activator Protein-1 in Cellular Proliferation Induced by the Human T-cell Leukemia Virus Type 1 Tax Oncoprotein. J. Biol. Chem. 281: 8927-8938 [Abstract] [Full Text]  
  • Theodoropoulou, M., Zhang, J., Laupheimer, S., Paez-Pereda, M., Erneux, C., Florio, T., Pagotto, U., Stalla, G. K. (2006). Octreotide, a Somatostatin Analogue, Mediates Its Antiproliferative Action in Pituitary Tumor Cells by Altering Phosphatidylinositol 3-Kinase Signaling and Inducing Zac1 Expression. Cancer Res. 66: 1576-1582 [Abstract] [Full Text]  
  • Kang, S., Denley, A., Vanhaesebroeck, B., Vogt, P. K. (2006). Oncogenic transformation induced by the p110beta, -{gamma}, and -{delta} isoforms of class I phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA 103: 1289-1294 [Abstract] [Full Text]  
  • Zhao, J. J., Liu, Z., Wang, L., Shin, E., Loda, M. F., Roberts, T. M. (2005). The oncogenic properties of mutant p110{alpha} and p110{beta} phosphatidylinositol 3-kinases in human mammary epithelial cells. Proc. Natl. Acad. Sci. USA 102: 18443-18448 [Abstract] [Full Text]  
  • Luo, J., McMullen, J. R., Sobkiw, C. L., Zhang, L., Dorfman, A. L., Sherwood, M. C., Logsdon, M. N., Horner, J. W., DePinho, R. A., Izumo, S., Cantley, L. C. (2005). Class IA Phosphoinositide 3-Kinase Regulates Heart Size and Physiological Cardiac Hypertrophy. Mol. Cell. Biol. 25: 9491-9502 [Abstract] [Full Text]  
  • Yee, M.-c., Fas, S. C., Stohlmeyer, M. M., Wandless, T. J., Cimprich, K. A. (2005). A Cell-permeable, Activity-based Probe for Protein and Lipid Kinases. J. Biol. Chem. 280: 29053-29059 [Abstract] [Full Text]  
  • Luo, J., Field, S. J., Lee, J. Y., Engelman, J. A., Cantley, L. C. (2005). The p85 regulatory subunit of phosphoinositide 3-kinase down-regulates IRS-1 signaling via the formation of a sequestration complex. JCB 170: 455-464 [Abstract] [Full Text]  
  • Shekar, S. C., Wu, H., Fu, Z., Yip, S.-C., Nagajyothi, , Cahill, S. M., Girvin, M. E., Backer, J. M. (2005). Mechanism of Constitutive Phosphoinositide 3-Kinase Activation by Oncogenic Mutants of the p85 Regulatory Subunit. J. Biol. Chem. 280: 27850-27855 [Abstract] [Full Text]  
  • Luo, J., Sobkiw, C. L., Logsdon, N. M., Watt, J. M., Signoretti, S., O'Connell, F., Shin, E., Shim, Y., Pao, L., Neel, B. G., DePinho, R. A., Loda, M., Cantley, L. C. (2005). Modulation of epithelial neoplasia and lymphoid hyperplasia in PTEN+/- mice by the p85 regulatory subunits of phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA 102: 10238-10243 [Abstract] [Full Text]  
  • Ikenoue, T., Kanai, F., Hikiba, Y., Obata, T., Tanaka, Y., Imamura, J., Ohta, M., Jazag, A., Guleng, B., Tateishi, K., Asaoka, Y., Matsumura, M., Kawabe, T., Omata, M. (2005). Functional Analysis of PIK3CA Gene Mutations in Human Colorectal Cancer. Cancer Res. 65: 4562-4567 [Abstract] [Full Text]  
  • Brachmann, S. M., Yballe, C. M., Innocenti, M., Deane, J. A., Fruman, D. A., Thomas, S. M., Cantley, L. C. (2005). Role of Phosphoinositide 3-Kinase Regulatory Isoforms in Development and Actin Rearrangement. Mol. Cell. Biol. 25: 2593-2606 [Abstract] [Full Text]  
  • Brachmann, S. M., Ueki, K., Engelman, J. A., Kahn, R. C., Cantley, L. C. (2005). Phosphoinositide 3-Kinase Catalytic Subunit Deletion and Regulatory Subunit Deletion Have Opposite Effects on Insulin Sensitivity in Mice. Mol. Cell. Biol. 25: 1596-1607 [Abstract] [Full Text]  
  • Voigt, P., Brock, C., Nurnberg, B., Schaefer, M. (2005). Assigning Functional Domains within the p101 Regulatory Subunit of Phosphoinositide 3-Kinase {gamma}. J. Biol. Chem. 280: 5121-5127 [Abstract] [Full Text]  
  • Barbee, S. D., Alberola-Ila, J. (2005). Phosphatidylinositol 3-Kinase Regulates Thymic Exit. J. Immunol. 174: 1230-1238 [Abstract] [Full Text]  
  • Chua, J., Deretic, V. (2004). Mycobacterium tuberculosis Reprograms Waves of Phosphatidylinositol 3-Phosphate on Phagosomal Organelles. J. Biol. Chem. 279: 36982-36992 [Abstract] [Full Text]  
  • Kharas, M. G., Deane, J. A., Wong, S., O'Bosky, K. R., Rosenberg, N., Witte, O. N., Fruman, D. A. (2004). Phosphoinositide 3-kinase signaling is essential for ABL oncogene-mediated transformation of B-lineage cells. Blood 103: 4268-4275 [Abstract] [Full Text]  
  • Foukas, L. C., Panayotou, G., Shepherd, P. R. (2004). Direct Interaction of Major Histocompatibility Complex Class II-derived Peptides with Class Ia Phosphoinositide 3-Kinase Results in Dose-dependent Stimulatory Effects. J. Biol. Chem. 279: 7505-7511 [Abstract] [Full Text]  
  • Chen, D., Mauvais-Jarvis, F., Bluher, M., Fisher, S. J., Jozsi, A., Goodyear, L. J., Ueki, K., Kahn, C. R. (2004). p50{alpha}/p55{alpha} Phosphoinositide 3-Kinase Knockout Mice Exhibit Enhanced Insulin Sensitivity. Mol. Cell. Biol. 24: 320-329 [Abstract] [Full Text]  
  • Ueki, K., Fruman, D. A., Yballe, C. M., Fasshauer, M., Klein, J., Asano, T., Cantley, L. C., Kahn, C. R. (2003). Positive and Negative Roles of p85{alpha} and p85{beta} Regulatory Subunits of Phosphoinositide 3-Kinase in Insulin Signaling. J. Biol. Chem. 278: 48453-48466 [Abstract] [Full Text]  
  • Lu, Y., Yu, Q., Liu, J. H., Zhang, J., Wang, H., Koul, D., McMurray, J. S., Fang, X., Yung, W.K. A., Siminovitch, K. A., Mills, G. B. (2003). Src Family Protein-tyrosine Kinases Alter the Function of PTEN to Regulate Phosphatidylinositol 3-Kinase/AKT Cascades. J. Biol. Chem. 278: 40057-40066 [Abstract] [Full Text]  
  • Riggins, R. B., DeBerry, R. M., Toosarvandani, M. D., Bouton, A. H. (2003). Src-Dependent Association of Cas and p85 Phosphatidylinositol 3'-Kinase in v-crk-Transformed Cells. Mol Cancer Res 1: 428-437 [Abstract] [Full Text]  
  • Fu, Z., Aronoff-Spencer, E., Backer, J. M., Gerfen, G. J. (2003). From the Cover: The structure of the inter-SH2 domain of class IA phosphoinositide 3-kinase determined by site-directed spin labeling EPR and homology modeling. Proc. Natl. Acad. Sci. USA 100: 3275-3280 [Abstract] [Full Text]  
  • Hallmann, D., Trumper, K., Trusheim, H., Ueki, K., Kahn, C. R., Cantley, L. C., Fruman, D. A., Horsch, D. (2003). Altered Signaling and Cell Cycle Regulation in Embryonal Stem Cells with a Disruption of the Gene for Phosphoinositide 3-Kinase Regulatory Subunit p85alpha. J. Biol. Chem. 278: 5099-5108 [Abstract] [Full Text]  
  • Brock, C., Schaefer, M., Reusch, H. P., Czupalla, C., Michalke, M., Spicher, K., Schultz, G., Nurnberg, B. (2003). Roles of G{beta}{gamma} in membrane recruitment and activation of p110{gamma}/p101 phosphoinositide 3-kinase {gamma}. JCB 160: 89-99 [Abstract] [Full Text]  
  • Jimenez, C., Hernandez, C., Pimentel, B., Carrera, A. C. (2002). The p85 Regulatory Subunit Controls Sequential Activation of Phosphoinositide 3-Kinase by Tyr Kinases and Ras. J. Biol. Chem. 277: 41556-41562 [Abstract] [Full Text]  
  • Ueki, K., Fruman, D. A., Brachmann, S. M., Tseng, Y.-H., Cantley, L. C., Kahn, C. R. (2002). Molecular Balance between the Regulatory and Catalytic Subunits of Phosphoinositide 3-Kinase Regulates Cell Signaling and Survival. Mol. Cell. Biol. 22: 965-977 [Abstract] [Full Text]  
  • von Gise, A., Lorenz, P., Wellbrock, C., Hemmings, B., Berberich-Siebelt, F., Rapp, U. R., Troppmair, J. (2001). Apoptosis Suppression by Raf-1 and MEK1 Requires MEK- and Phosphatidylinositol 3-Kinase-Dependent Signals. Mol. Cell. Biol. 21: 2324-2336 [Abstract] [Full Text]  
  • Ueki, K., Algenstaedt, P., Mauvais-Jarvis, F., Kahn, C. R. (2000). Positive and Negative Regulation of Phosphoinositide 3-Kinase-Dependent Signaling Pathways by Three Different Gene Products of the p85alpha Regulatory Subunit. Mol. Cell. Biol. 20: 8035-8046 [Abstract] [Full Text]  
  • Arcaro, A., Zvelebil, M. J., Wallasch, C., Ullrich, A., Waterfield, M. D., Domin, J. (2000). Class II Phosphoinositide 3-Kinases Are Downstream Targets of Activated Polypeptide Growth Factor Receptors. Mol. Cell. Biol. 20: 3817-3830 [Abstract] [Full Text]  
  • Lu-Kuo, J. M., Fruman, D. A., Joyal, D. M., Cantley, L. C., Katz, H. R. (2000). Impaired Kit- but Not Fcepsilon RI-initiated Mast Cell Activation in the Absence of Phosphoinositide 3-Kinase p85alpha Gene Products. J. Biol. Chem. 275: 6022-6029 [Abstract] [Full Text]  
  • Aoki, M., Schetter, C., Himly, M., Batista, O., Chang, H. W., Vogt, P. K. (2000). The Catalytic Subunit of Phosphoinositide 3-Kinase: Requirements for Oncogenicity. J. Biol. Chem. 275: 6267-6275 [Abstract] [Full Text]  
  • Hill, K., Welti, S., Yu, J., Murray, J. T., Yip, S.-C., Condeelis, J. S., Segall, J. E., Backer, J. M. (2000). Specific Requirement for the p85-p110alpha Phosphatidylinositol 3-Kinase during Epidermal Growth Factor-stimulated Actin Nucleation in Breast Cancer Cells. J. Biol. Chem. 275: 3741-3744 [Abstract] [Full Text]  
  • Beitz, L. O., Fruman, D. A., Kurosaki, T., Cantley, L. C., Scharenberg, A. M. (1999). SYK Is Upstream of Phosphoinositide 3-Kinase in B Cell Receptor Signaling. J. Biol. Chem. 274: 32662-32666 [Abstract] [Full Text]  
  • Maier, U., Babich, A., Nurnberg, B. (1999). Roles of Non-catalytic Subunits in Gbeta gamma -induced Activation of Class I Phosphoinositide 3-Kinase Isoforms beta and gamma. J. Biol. Chem. 274: 29311-29317 [Abstract] [Full Text]  
  • Tiganis, T., Kemp, B. E., Tonks, N. K. (1999). The Protein-tyrosine Phosphatase TCPTP Regulates Epidermal Growth Factor Receptor-mediated and Phosphatidylinositol 3-Kinase-dependent Signaling. J. Biol. Chem. 274: 27768-27775 [Abstract] [Full Text]  
  • Krugmann, S., Hawkins, P. T., Pryer, N., Braselmann, S. (1999). Characterizing the Interactions between the Two Subunits of the p101/p110gamma Phosphoinositide 3-Kinase and Their Role in the Activation of This Enzyme by Gbeta gamma Subunits. J. Biol. Chem. 274: 17152-17158 [Abstract] [Full Text]  
  • Harpur, A. G., Layton, M. J., Das, P., Bottomley, M. J., Panayotou, G., Driscoll, P. C., Waterfield, M. D. (1999). Intermolecular Interactions of the p85alpha Regulatory Subunit of Phosphatidylinositol 3-Kinase. J. Biol. Chem. 274: 12323-12332 [Abstract] [Full Text]  
  • Bi, L., Okabe, I., Bernard, D. J., Wynshaw-Boris, A., Nussbaum, R. L. (1999). Proliferative Defect and Embryonic Lethality in Mice Homozygous for a Deletion in the p110alpha Subunit of Phosphoinositide 3-Kinase. J. Biol. Chem. 274: 10963-10968 [Abstract] [Full Text]  
  • Hunter, S., Burton, E. A., Wu, S. C., Anderson, S. M. (1999). Fyn Associates with Cbl and Phosphorylates Tyrosine 731 in Cbl, A Binding Site for Phosphatidylinositol 3-Kinase. J. Biol. Chem. 274: 2097-2106 [Abstract] [Full Text]  
  • Fruman, D. A., Snapper, S. B., Yballe, C. M., Davidson, L., Yu, J. Y., Alt, F. W., Cantley, L. C. (1999). Impaired B Cell Development and Proliferation in Absence of Phosphoinositide 3-Kinase p85. Science 283: 393-397 [Abstract] [Full Text]  
  • Siddhanta, U., McIlroy, J., Shah, A., Zhang, Y., Backer, J. M. (1998). Distinct Roles for the p110{alpha} and hVPS34 Phosphatidylinositol 3'-Kinases in Vesicular Trafficking, Regulation of the Actin Cytoskeleton, and Mitogenesis. JCB 143: 1647-1659 [Abstract] [Full Text]  
  • Layton, M. J., Harpur, A. G., Panayotou, G., Bastiaens, P. I. H., Waterfield, M. D. (1998). Binding of a Diphosphotyrosine-containing Peptide That Mimics Activated Platelet-derived Growth Factor Receptor beta  Induces Oligomerization of Phosphatidylinositol 3-Kinase. J. Biol. Chem. 273: 33379-33385 [Abstract] [Full Text]  
  • Yu, J., Wjasow, C., Backer, J. M. (1998). Regulation of the p85/p110alpha Phosphatidylinositol 3'-Kinase. DISTINCT ROLES FOR THE N-TERMINAL AND C-TERMINAL SH2 DOMAINS. J. Biol. Chem. 273: 30199-30203 [Abstract] [Full Text]  
  • Cuevas, B. D., Lu, Y., Mao, M., Zhang, J., LaPushin, R., Siminovitch, K., Mills, G. B. (2001). Tyrosine Phosphorylation of p85 Relieves Its Inhibitory Activity on Phosphatidylinositol 3-Kinase. J. Biol. Chem. 276: 27455-27461 [Abstract] [Full Text]  
  • Gonzalez-Garcia, A., Garrido, E., Hernandez, C., Alvarez, B., Jimenez, C., Cantrell, D. A., Pullen, N., Carrera, A. C. (2002). A New Role for the p85-Phosphatidylinositol 3-Kinase Regulatory Subunit Linking FRAP to p70 S6 Kinase Activation. J. Biol. Chem. 277: 1500-1508 [Abstract] [Full Text]  
  • Seykora, J. T., Mei, L., Dotto, G. P., Stein, P. L. (2002). `Srcasm: a Novel SrcActivating and Signaling Molecule. J. Biol. Chem. 277: 2812-2822 [Abstract] [Full Text]  
  • Ueki, K., Yballe, C. M., Brachmann, S. M., Vicent, D., Watt, J. M., Kahn, C. R., Cantley, L. C. (2002). Increased insulin sensitivity in mice lacking p85beta subunit of phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA 99: 419-424 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Yu, J.
Right arrow Articles by Backer, J. M.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Yu, J.
Right arrow Articles by Backer, J. M.