Previous Article | Next Article 
Mol Cell Biol, March 1998, p. 1379-1387, Vol. 18, No. 3
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
Regulation of the p85/p110 Phosphatidylinositol 3'-Kinase:
Stabilization and Inhibition of the p110
Catalytic Subunit by
the p85 Regulatory Subunit
Jinghua
Yu,
Yitao
Zhang,
James
McIlroy,
Tamara
Rordorf-Nikolic,
George A.
Orr, and
Jonathan M.
Backer*
Department of Molecular Pharmacology, Albert
Einstein College of Medicine, Bronx, New York 10461
Received 7 July 1997/Returned for modification 9 September
1997/Accepted 1 December 1997
 |
ABSTRACT |
We propose a novel model for the regulation of the p85/p110
phosphatidylinositol 3'-kinase. In insect cells, the p110
catalytic subunit is active as a monomer but its activity is decreased by coexpression with the p85 regulatory subunit. Similarly, the lipid kinase activity of recombinant glutathione S-transferase
(GST)-p110
is reduced by 65 to 85% upon in vitro reconstitution
with p85. Incubation of p110
/p85 dimers with phosphotyrosyl peptides
restored activity, but only to the level of monomeric p110
. These
data show that the binding of phosphoproteins to the SH2 domains of p85
activates the p85/p110
dimers by inducing a transition from an
inhibited to a disinhibited state. In contrast, monomeric p110 had
little activity in HEK 293T cells, and its activity was increased 15- to 20-fold by coexpression with p85. However, this apparent requirement
for p85 was eliminated by the addition of a bulky tag to the N terminus
of p110
or by the growth of the HEK 293T cells at 30°C. These
nonspecific interventions mimicked the effects of p85 on p110
,
suggesting that the regulatory subunit acts by stabilizing the overall
conformation of the catalytic subunit rather than by inducing a
specific activated conformation. This stabilization was directly
demonstrated in metabolically labeled HEK 293T cells, in which p85
increased the half-life of p110. Furthermore, p85 protected p110 from
thermal inactivation in vitro. Importantly, when we examined the effect
of p85 on GST-p110
in mammalian cells at 30°C, culture conditions
that stabilize the catalytic subunit and that are similar to the
conditions used for insect cells, we found that p85 inhibited p110
.
Thus, we have experimentally distinguished two effects of p85 on
p110
: conformational stabilization of the catalytic subunit and
inhibition of its lipid kinase activity. Our data reconcile the
apparent conflict between previous studies of insect versus mammalian
cells and show that p110
is both stabilized and inhibited by
dimerization with p85.
 |
INTRODUCTION |
Phosphatidylinositol (PI) 3'-kinases
constitute a family of enzymes that mediate intracellular signaling
initiated by receptor tyrosine kinases and heterotrimeric
G-protein-coupled receptors. Activation of PI 3'-kinase leads to
increases in the intracellular levels of PI[3,4]P2 and
PI[3,4,5]P3, which are presumed second messengers
(4). PI 3'-kinases have been implicated in the control of
proliferation, cytoskeletal organization, apoptosis, and vesicular trafficking (6, 16, 20, 31, 46).
A classification of PI 3'-kinases has been described by Zvelebil and
coworkers (48). The class I enzymes are heterodimeric proteins that are composed of separate regulatory and catalytic subunits and that utilize PI, PI[4]P, and PI[4,5]P2 as
substrates. Class I enzymes include the p85/p110 PI 3'-kinase, which is
activated by binding to phosphotyrosyl proteins, and the p101/p120 PI
3-kinase-
isoform, which is activated by 
subunits from
trimeric G proteins (11, 13, 38, 39). Class II PI 3'-kinases
contain C-terminal C2 domains and preferentially utilize PI and
PI[4]P as substrates (24, 26, 43). Class III enzymes
include the yeast VPS34 and its mammalian homolog (35, 44)
and recognize PI but not higher-order phosphoinositides as substrates.
Regulation of the p85/p110 PI 3'-kinase is complex. Two homologous p85
regulatory subunits have been identified (9, 27, 36). Each
contains an N-terminal SH3 domain followed by a proline rich domain, a
breakpoint cluster region (BCR) homology domain, a second proline-rich
domain, and two SH2 domains. Shorter forms (p55) lacking the SH3 and
BCR homology domains have also been cloned (1, 29). All the
p85/p55 proteins contain putative coiled-coil domains that mediate
stable dimerization with the p110 catalytic subunit (7). The
three known isoforms of p110 catalytic subunits (p110
, p110
, and
p110
) contain closely spaced N-terminal binding sites for p85 and
p21ras-GTP, as well as C-terminal kinase domains (12, 14, 18, 32,
42). In vitro studies have shown that the p85 SH3 domain binds to
proline-rich peptides, the proline-rich domains bind to SH3 domains
from Fyn and Lyn, the BCR homology domain binds to GTP-loaded CDC42,
and the SH2 domains bind to tyrosyl phosphopeptides (3, 17, 37,
41, 47). Each of these binding events activates p85/p110
PI
3'-kinase in vitro, although it is not clear yet whether these distinct activating interactions are redundant or additive (2, 10, 28,
47). p110
binding to p21ras-GTP was also found to increase PI
3'-kinase activity in an in vitro assay using lipid vesicles as the
substrates (32). However, this increase in activity may reflect the targeting of p110
to the lipid vesicles, since
nonisoprenylated GTP-ras binds to p110 but does not activate it in
vitro.
The p85 regulatory subunit of PI 3'-kinase has been generally viewed as
an activator of p110
. Several groups have reported that p110
is
catalytically inactive as a monomer in Cos cells and requires
coexpression with p85 for activity (11, 18). In fact, the
p110
binding domain from p85 (the inter-SH2 [iSH2] domain) has
been tethered to the N terminus of p110
to produce a constitutively
active PI 3'-kinase (15). However, p110
is active when
expressed in baculovirus-infected Sf-9 cells (11). In
addition, p110
is active as a monomer in HEK 293T cells
(13). Interestingly, the studies reporting that p110
is
inactive as a monomer in mammalian cells used C-terminal tags or
C-terminally directed antibodies, whereas the study reporting active
monomeric p110
used an N-terminal tag inserted between residues 30 and 31 (11, 13, 15, 18).
In this study, we have examined the mechanism by which p85 regulates
p110
activity. In insect cells, p110
is an active monomer that is
reversibly inhibited by stable binding to p85. Activation of
recombinant p85/p110
by phosphotyrosyl proteins reflects a disinhibition of the p85/p110
dimer. In contrast, monomeric p110 had
little activity in HEK 293T cells, and its activity was increased 15- to 20-fold by coexpression with p85. However, this requirement can be
completely supplanted by either the addition of an N-terminal glutathione S-transferase (GST) tag or culture of the
mammalian cells at 30°C. Under conditions that stabilize monomeric
p110
in mammalian cells (GST-p110
in cells grown at 30°C),
coexpression of GST-p110
with p85 causes an inhibition of activity
similar to that seen in insect cells. Our data show that p85 acts by
both stabilizing and inhibiting the p110
catalytic subunit.
 |
MATERIALS AND METHODS |
Antibodies and Western blotting.
Affinity-purified rabbit
antibodies against residues 324 to 721 of human p85 have been
previously described (2). Antibodies against p110
(AE-40)
were produced by immunizing rabbits with a GST fusion protein
containing residues 1 to 140 of bovine p110
. The antibodies were
affinity purified with a column made by coupling the same GST fusion
protein to Affigel (Bio-Rad). All Western blots were visualized with
primary and secondary antibodies (where required) and
125I-protein A (New England Nuclear) and quantitated with a
Molecular Dynamics PhosphorImager.
Mutagenesis of p85 and p110.
Construction of N-terminally
hemagglutinin (HA)-tagged p85 has been previously described
(33). Mutation of Ser-608 to alanine was performed by the
method of Kunkel et al. (23). Bovine p110
(provided by M. Waterfield, Ludwig Institute for Cancer Research) was mutated with the
pALTER system (Promega). A new XhoI site was inserted
between the first and second codons of the p110
cDNA, which allowed
the insertion of double-stranded cassettes between an upstream
BamHI site and the XhoI site. The cassettes contained an idealized Kozak sequence (21, 22) followed by the initial ATG and the various epitope tags. The myc tag was inserted
with anticomplementary synthetic oligonucleotides. The Tris-HA tag was
subcloned from a vector provided by E. Skolnik, New York University, by
PCR. The GST tag was subcloned from the pGEX-2T vector (Pharmacia) by
using PCR. The resulting sequences, inserted immediately N-terminal to
Pro-2 of p110
, were as follows: p110
/N-myc-p110:
MAEEQKLISEEDLRRG; 3HA-p110
:
MPRGGGRIFYPYDVPDTAGYPYDVPDYAGSTPYDVPDYAAQCGRARG; GST-p110
:
M-(GST)-LVPRGSRG. To produce C-terminally myc-tagged p110
, a new
BglII site was inserted immediately 5' to the stop codon of
the p110
cDNA, and anticomplementary synthetic
nucleotides were used to insert the sequence
RSDLGEQKLISEEDLG-STOP. All constructions were
confirmed by sequencing. The p110
cDNA constructs were subcloned into the pSG5 expression vector (Stratagene) for expression in mammalian cells; the HA-p85 cDNA construct was subcloned into the
expression vector pCMVhis (40). All plasmids were purified by equilibrium centrifugation in CsCl.
Preparation of recombinant PI 3'-kinase in Sf-9 cells.
The
p85 and p110
gene constructs were subcloned into pBluebacIII
(Invitrogen) and cotransfected into Sf-9 cells with Baculogold (Pharmingen) linearized baculovirus DNA, which contains a lethal mutation rescued by recombination with the baculovirus transfer vector.
Recombinant virus was amplified 2 or 3 times to produce high-titer
stocks. To produce the recombinant proteins, Sf-9 cells were grown in
six-well dishes and infected with recombinant baculovirus. After 3 days
in culture, the cells were washed in ice-cold phosphate-buffered saline
and lysed by cycles of freezing and thawing in 10 mM Tris (pH 7.4)-150
mM NaCl-1 mM EDTA-100 µg of aprotinin per ml-1 µg of leupeptin
per ml-350 µg of phenylmethylsulfonyl fluoride per ml (baculolysis
buffer). After removal of particulate material by centrifugation at
12,000 × g, the lysates were assayed directly for PI
3'-kinase activity with sonicated bovine liver PI (200 µg/ml) and ATP
(45 µM) as described by Ruderman et al. (34).
Purification of GST-p110.
Sf-9 cells, grown in two
15-cm-diameter dishes, were infected with GST-p110
baculovirus.
After 48 h, the cells were lysed in 20 mM Tris (pH 7.5)-137 mM
NaCl-1 mM CaCl2-1 mM MgCl2-1% Nonidet P-40
(NP-40)-10% glycerol (NP-40 lysis buffer). After centrifugation at
12,000 × g to remove particulate material, the lysate
was passed twice over glutathione-Sepharose, washed with 20 column
volumes of 10 mM Tris (pH 7.4)-150 mM NaCl, and eluted with 50 mM Tris (pH 7.4) containing 10 mM glutathione. The eluate was assayed directly
for lipid kinase activity; control experiments showed that this buffer
did not affect the activity of recombinant p110
. Peak fractions were
assayed in the absence or presence of p85 as described above.
p85 and p110
mixing and coexpression experiments.
Lysates
from Sf-9 cells expressing wild-type p85 or mutant p85 or lysates from
uninfected Sf-9 cells (approximately 20 µg of protein) were mixed
with lysates from Sf-9 cells expressing wild-type or tagged p110
(approximately 60 µg of total protein). After 30 min on ice, the
samples were assayed for PI 3'-kinase activity as described below.
Where indicated, the p85 was first immunopurified by absorption onto
protein A-Sepharose with an antibody that recognizes the C-terminal SH2
domain of p85 antibody; we have previously shown that this antibody
does not affect p85/p110 activity (25). p110 activity was
measured in the presence of the washed p85/protein A beads.
Alternatively, Sf-9 cells were coinfected with baculovirus coding for
p110
and p85. Duplicate samples were assayed for PI 3'-kinase
activity as previously described (34); assays used mixtures
including 10 mM MgCL2, 40 µM ATP containing 20 µCi of
[32P]ATP/assay, and 200 µM PI. Background lipid kinase
activity present in lysates from uninfected Sf-9 cells was subtracted.
Parallel samples were assayed for p110
expression by immunoblotting
with anti-p110
antibodies. For analysis of PI[4]P and
PI[4,5]P2 phosphorylation, assays contained sonicated
mixtures of 10 µg of phosphatidylserine, 5 µg of PI, and 10 µg of
either PI[4]P or PI[4,5]P2 and were conducted with 500 µM ATP. After extraction in acidic chloroform-methanol (1:1), the
organic phase was washed with 1 volume of synthetic upper phase and
analyzed by thin-layer chromatography in 1-propanol-2 M acetic acid
(65:35).
PI 3'-kinase kinetic analysis.
Recombinant p110
monomers
were incubated in the absence or presence of wild-type or mutant p85 as
described above and then incubated for an additional 60 min in the
absence or presence of a 1 µM concentration of a bisphosphopeptide
derived from p85 binding sequences in IRS-1
[DD(P)YMPMSPGAGAGAGAGAGNGD(P)YMPMSPKS] (33). For the
kinetic analysis with variable lipid concentrations (Fig. 2 and Table
1), the mixtures were assayed in a solution containing 10 mM
MgCl2, 1 mM ATP, 20 µCi of [32P]ATP per
assay, and 0 to 1,000 µM PI. For the kinetic analysis with variable
ATP, the mixtures were assayed in a solution containing 10 mM
MgCl2, 20 µCi of [32P]ATP per assay, 400 µM phospholipid, and 0 to 600 µM ATP. After 10 min at 22°C, the
lipids were extracted and lipid kinase activity was measured
(34). Incorporation of [32P]ATP into the
phospholipid was quantitated with a Molecular Dynamics PhosphorImager, and the result was converted to counts per
minute by quantifying serial dilutions of [32P]ATP with
the PhosphorImager. All determinations were made in duplicate.
Kinetic analysis was performed with Kaleidograph software.
Analysis of p85 serine phosphorylation.
Sf-9 cells were
infected with p85 baculovirus. After 48 h, the cells were washed
into phosphate-free Graces medium and incubated with
[32P]orthophosphate (0.5 mCi/ml) for 4 h. The cells
were lysed as described above in baculolysis buffer containing 100 mM
NaF, 10 mM sodium pyrophosphate, and 100 µM orthovanadate.
Alternatively, the cells were lysed in buffer without phosphatase
inhibitors and then incubated for 1 h at 30°C in 2 mM
dithiothreitol-2 mM MnCl2-0.5 µg of recombinant protein
phosphatase 1 (provided by Z.-Y. Zhang, Albert Einstein College of
Medicine). The proteins were diluted to 0.5 ml, immunoprecipitated with
anti-p85 antibody and protein A-Sepharose, eluted in sample buffer, and
separated by reducing sodium dodecyl sulfate-7.5% polyacrylamide gel
electrophoresis (SDS-7.5% PAGE). Proteins were visualized by
autoradiography, and 32P incorporation was quantitated with
a Molecular Dynamics PhosphorImager.
Production of recombinant PI 3'-kinase in HEK 293T cells.
Confluent HEK 293T cells (provided by J. Krolewski, Columbia
University) were split 1:10 24 h prior to transfection,
preincubated in 25 µM chloroquine, and transfected with 30 to 45 µg
of expression vectors for N-myc-p110
, C-myc-p110
, 3HA-p110
,
GST-p110
, and p85 or with empty vector by a calcium-phosphate
precipitation method. After 48 h the cells were solubilized, and
PI 3'-kinase was immunoprecipitated with monoclonal anti-myc antibody
(9E10; Oncogene Science), monoclonal anti-HA antibody (12CA5), or
polyclonal anti-GST antibody (Pharmacia). After absorption of the
lysate to protein G-Sepharose beads (Pharmacia), the beads were washed and lipid kinase activity was determined as described by Ruderman et
al. (34), with quantitation with a Molecular Dynamics
PhosphorImager. All determinations were made in triplicate.
Immunoprecipitates from parallel samples were blotted with anti-p110
or anti-p85 antibodies.
Metabolic labeling experiments.
HEK 293T cells were
transfected with expression vectors for C-myc-p110 in the absence or
presence of p85 as described above. Thirty-six hours after
transfection, the cells were incubated in methionine-free medium
containing 10% fetal bovine serum and 0.1 mCi of
[35S]methionine for 16 h. The cells were then washed
with phosphate-buffered saline and lysed or incubated for various times
in complete medium supplemented with 10× methionine. The cells were
lysed, and proteins were immunoprecipitated with anti-myc antibodies
and protein G-Sepharose beads eluted, separated by SDS-PAGE, and
visualized by autoradiography.
Heat inactivation.
Recombinant wild-type p110 was produced
in Sf-9 cells and incubated in buffer without or with recombinant p85
for 1 h at 4°C. The samples were then shifted to the indicated
temperatures for 30 min, chilled on ice, and assayed for lipid kinase
activity as described above.
 |
RESULTS |
p110
is active as a monomer in insect cells and is inhibited by
coexpression or reconstitution with p85.
We examined the effects
of p85 on p110
activity by using recombinant proteins expressed in
baculovirus-infected Sf-9 cells. p110
showed significant activity in
the absence of p85, consistent with previous reports (11)
(Fig. 1A). Coexpression with p85 increased the amount of p110
protein in Sf-9 lysates (Fig. 1B) but
decreased its activity dramatically (Fig. 1A), suggesting that p110
was inhibited by p85.

View larger version (32K):
[in this window]
[in a new window]
|
FIG. 1.
Expression of p110 in Sf-9 cells. (A) Control Sf-9
cells or p110 baculovirus-infected Sf-9 cells were additionally
infected without the p85 baculovirus or not infected. The cells were
lysed, and PI 3'-kinase activities in the lysate were measured. (B)
Western blot of parallel samples with anti-p110 antibody. (C) Left
panel: control Sf-9 lysates, lysates from cells expressing GST-p110 ,
or glutathione-Sepharose-purified GST-p110 was mixed with lysates
from cells expressing p85 as indicated. Lipid kinase activity was then
measured. Right panel: control Sf-9 lysates, lysates from cells
expressing GST-p110 , or glutathione-Sepharose-purified GST-p110
was mixed with immunopurified p85 as indicated, and PI 3'-kinase
activities were measured. All determinations were made in triplicate,
and the data are the means ± standard errors of the means from
three experiments.
|
|
We reconstituted the p85-induced inhibition of p110

by producing the
proteins separately in Sf-9 cells and then mixing them
in vitro;
p110

could be immunoprecipitated with anti-p85 antibodies
under
these conditions, demonstrating that the two formed a complex
(data not
shown). Incubation of GST-p110

with HA-tagged p85 caused
an 80%
decrease in lipid kinase activity (Fig.
1C, lane c). To
show that the
inhibition was not due to contaminating factors
in the Sf-9 cytosol, we
purified an identical amount of GST-p110
by absorption on
glutathione-Sepharose beads. Total p110

activity
was reduced
slightly, reflecting the loss of some GST-p110

from
the beads during
the washes (lane d). However, the purified GST-p110
was still
inhibited by incubation with p85 (lanes e and j). Similarly,
we
purified p85 by absorption with a highly specific anti-p85
antibody
and showed that the immunopurified p85 inhibited GST-p110
activity
in Sf-9 lysates (lane h) and in glutathione-Sepharose-purified
GST-p110

(lane j). These data show that the inhibition of p110
by
p85 does not require coexpression, as has been previously suggested
(
45). Moreover, purification of p110

and p85 had no
effect
on the inhibition of p110

by p85. Subsequent experiments were
performed with p110

and p85 in Sf-9 lysates, as purified GST-p110
was unstable and lost activity rapidly with storage (data not
shown).
We measured the activity of p110

and p85/p110

dimers in the
absence or presence of a bisphosphopeptide that activates heterodimeric
PI 3'-kinase in vitro (
33). Substrate velocity curves,
measured
in the presence of 1 mM ATP or 400 µM sonicated PI, were
obtained
for PI and ATP, respectively. A representative curve for PI is
shown in Fig.
2, and the calculated
kinetic data are shown in
Table
1. The
addition of p85 to p110

significantly decreased
the utilization of
both PI and ATP as substrates. Relative
Vmax/
Km values for PI and
ATP decreased by 85 and 60%, respectively, compared
to those seen with
p110

monomers. The addition of bisphosphopeptide
(Fig.
2A; Table
1)
restored the relative
Vmax/
Km values for lipid
and ATP to 75 and 95%, respectively, of those seen with p110
monomers. However, the activity of p85/p110

dimers in the presence
of activating phosphopeptide was never greater than the activity
of an
equivalent amount of monomeric p110

. The activity of monomeric
p110

was not affected by phosphopeptide (data not shown). The
inhibition of p110

by p85 was confirmed by using PI[4]P and
PI[4,5]P
2 as the substrates (Fig.
2B). The addition of
p85 inhibited p110
activity by 50 and 70% with PI[4]P and
PI[4,5]P
2, respectively.
The addition of
bisphosphopeptide increased the activity of p85/p110
dimers to 108 and 50%, respectively, of that seen with p110

monomers.

View larger version (22K):
[in this window]
[in a new window]
|
FIG. 2.
Lipid kinase activities of p110 monomers and
p85/p110 dimers. (A) N-myc p110 monomers were incubated for 30 min at 4°C in the absence or presence of p85 and then incubated for
an additional 60 min at 4°C in the absence or presence of 1 µM
bisphosphopeptide. The mixtures were assayed in the presence of 0 to
1,000 µM PI and 1 mM ATP. After 10 min at 22°C, the lipids were
extracted and analyzed as described in Materials and Methods. All
determinations were performed in duplicate, and the data are the means
from three separate experiments. Curves represent the best
Michaelis-Menten fit and were generated with Kaleidograph software. (B)
N-myc-p110 monomers or p85/N-myc-p110 dimers were incubated in the
absence or presence of phosphopeptide as described above. The samples
were assayed with sonicated mixtures of PI,PS and either PI[4]P or
PI[4,5]P2 as described in Materials and Methods. The data
are the means ± standard errors of the means for two (PIP) or
three (PIP2) experiments.
|
|
These data suggest that p85 inhibits the activity of p110

.
Subsequent activation of p85/p110

dimers by IRS-1 or phosphopeptides
reflects a disinhibition of p110

rather than a true increase
in
activity relative to p110

monomers.
Inhibition of p110
by p85 is independent of serine or threonine
phosphorylation.
Dhand et al. identified Ser-608 in the iSH2
domain of p85 as an inhibitory regulatory site (8). To
determine whether the observed inhibition of p110
could be due to
phosphorylation of Ser-608, we mutated the residue to alanine. The
p85-S608A mutant was expressed in Sf-9 cells as an 85-kDa polypeptide
(Fig. 3A) and showed no differences in
binding to p110
when compared to wild-type p85 (Fig. 3B). p85-S608A
was indistinguishable from wild-type p85 with regard to inhibition of
p110
; this was observed when monomeric p110
was mixed in vitro
with either p85 from Sf-9 lysates (Fig. 3C) or immunopurified p85 (Fig.
3D). Similarly, coinfection of Sf-9 cells with either wild-type p85 or
p85-S608A increased p110
expression (Fig. 3E, inset) but decreased
p110
activity (Fig. 3E). p85-S608A/p110
dimers could be activated by phosphopeptides to the same extent as wild-type p85/p110
dimers (Fig. 3F). Although it is possible that phosphorylation of Ser-608 has
an additional inhibitory function in the regulation of p110
, these
data show that the inhibition observed here does not depend on the
phosphorylation of this residue.

View larger version (32K):
[in this window]
[in a new window]
|
FIG. 3.
Inhibition of p110 by p85-S608A. (A) Expression of
wild-type p85 and p85-S608A in Sf-9 lysates was measured by blotting
with anti-p85 antibody. (B) Wild-type p85 and p85-S608A were
immobilized on anti-p85-protein A-Sepharose beads, incubated with
lysates from cells expressing N-myc-p110 , washed, and assayed for
lipid kinase activity. Lipid kinase activity bound to wild-type p85 was
defined as 100%. (C) Lysates from Sf-9 cells expressing N-myc-p110
were incubated in the absence or presence of wild-type p85 or p85-S608A
and then assayed for lipid kinase activity (expressed as a percentage
of lipid kinase activity in the absence of p85). (D) Lysates from Sf-9
cells expressing N-myc-p110 were incubated in the absence or
presence of immunopurified wild-type p85 or p85-S608A and then assayed
for lipid kinase activity (expressed as in panel C). (E) Sf-9 cells
were infected with N-myc-p110 alone or were coinfected with
wild-type p85 or p85-S608A. Lipid kinase activity in the cell lysates
was determined (expressed as in panel C). Inset: p110 expression was
determined by blotting with anti-p110 antibody. (F) Lysates
containing N-myc-p110 and wild-type p85 or p85-S608A were incubated
in the absence or presence of bisphosphopeptide (1 µM) for 1 h,
and lipid kinase activity was determined. Activation was expressed as
fold stimulation over activity in the absence of phosphopeptide. All
determinations were made in duplicate or triplicate, and the data are
the means ± standard errors of the means of four separate
experiments.
|
|
To determine whether other potential phosphorylation sites could
account for the observed inhibition of p110

by p85, we labeled
p85-infected Sf-9 cells with [
32P]orthophosphate and
immunoprecipitated them with anti-p85 antibodies.
p85 was
phosphorylated in Sf-9 cells but could be completely dephosphorylated
by treatment with protein phosphatase 1 (Fig.
4A). Dephosphorylated
p85 was fully
capable of inhibiting p110

when mixed with the
enzyme in vitro (Fig.
4B). Our data suggest that phosphorylation
of p85 is not required for
its inhibition of p110

.

View larger version (36K):
[in this window]
[in a new window]
|
FIG. 4.
Inhibition of p110 by dephosphorylated p85. (A)
Forty-eight hours after infection with p85 baculovirus, Sf-9 cells were
labeled with [32P]orthophosphate for 4 h. The cells
were lysed, treated with recombinant protein phosphatase 1 (0.5 µg)
or not treated, and immunoprecipitated with anti-p85-protein
A-Sepharose beads. Proteins were eluted and separated by SDS-PAGE, and
the dried gel was visualized by autoradiography and quantitated with a
Molecular Dynamics PhosphorImager. (B) Lysates from Sf-9 cells
expressing p85 were treated in the absence or presence of recombinant
protein phosphatase 1 (0.5 µg). p85 was purified by absorption on
anti-p85-protein A-Sepharose beads and mixed with p110 , and lipid
kinase activity was determined. All determinations were made in
triplicate, and the data are the means ± standard errors of the
means of two separate experiments.
|
|
Activity of monomeric p110
in mammalian cells: requirement for
p85 is supplanted by bulky N-terminal tags.
In contrast with the
data from insect cells, several laboratories have suggested that
p110
expressed in mammalian cells is inactive as a monomer and
requires binding to p85 for activity (11, 18). However,
p110
is highly active as a monomer in mammalian cells
(13). Although the reason for these discrepancies has not
been clear, we noted that the studies examining p110
used C-terminal
epitope tags, whereas the study with p110
used an N-terminal tag, a
Tris-HA cassette inserted between residues 30 and 31.
We reexamined this question with HEK 293T cells by transiently
expressing bovine p110

containing an epitope tag at either
its N or
C terminus. In agreement with previous reports, C-terminally
myc-tagged
p110

had little activity as a monomer, but its specific
activity was
increased nearly 20-fold by coexpression with p85
(Fig.
5A). Interestingly, placement of the myc
tag at the N terminus
of p110

increased its specific activity
eightfold relative to
the activity of C-myc-110. The specific activity
of N-myc-p110
was increased approximately threefold more by
coexpression with
p85, i.e., to a level similar to that seen in cells
transfected
with C-myc-p110

and p85.

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 5.
Activity of epitope-tagged p110 : comparison of
N-terminal versus C-terminal tags. (A) HEK 293T cells were transfected
with expression vectors for C-myc- or N-myc-p110 (30 µg) plus
control vector or an expression vector for p85 (30 µg). Forty-eight
hours after transfection the cells were lysed, and anti-myc
immunoprecipitates were prepared. The immune complexes were assayed for
lipid kinase activity. Parallel samples were eluted, separated by
SDS-PAGE, and blotted sequentially with anti-p110 and anti-p85
antibodies. PI 3'-kinase specific activity was calculated relative to
p110 expression, as measured by blotting. Data from different
experiments were normalized to the activity of C-myc-p110 in each
experiment. All determinations were performed in triplicate, and the
data are the means ± standard errors of the means from five
separate experiments. (B) HEK 293T cells were transfected with 30 (C-myc-p110 , N-myc-p110 , and GST-p110 ) or 45 µg
(3HA-p110 ) of DNA. The cells were lysed after 48 h, and
anti-myc, anti-HA, and anti-GST immunoprecipitates were prepared. Lipid
and protein determinations and data normalization were performed as
described for panel A. All determinations were performed in triplicate,
and the data are the means ± standard errors of the means from
four separate experiments.
|
|
We next compared the activities of p110

isoforms containing various
N-terminal tags. p110

was modified by the addition of
myc, Tris-HA,
or GST tags as indicated and expressed in HEK 293T
cells. As seen
before, placement of the myc tag at the N terminus
of p110

increased
its activity by approximately eightfold relative
to C-myc-p110

(Fig.
5B). However, an N-terminal Tris-HA cassette
(38 amino acids) increased
activity by 20-fold relative to C-myc-p110

,
whereas an N-terminal
GST tag increased activity by 45-fold (Fig.
5B). It should be noted
that the expressed proteins were immunoprecipitated
with different
antitag antibodies, making it difficult to directly
compare their
expression levels. Nonetheless, the immunoprecipitates
were assayed
under identical conditions and were subjected to
blotting with the same
anti-p110 antibody. Thus, the determination
of p110 specific activity
was unaffected by potential differences
in recovery during
immunoprecipitation.
These data suggest that in mammalian cells, the attachment of a bulky
N-terminal tag to the amino terminus of p110

can substitute
for p85,
which also binds to the N terminus of p110

. We therefore
examined
the effect of p85 on the C-myc-p110 and GST-p110 constructs.
HEK 293T
cells were transfected with C-myc-p110 and GST-p110 (30
and 5 µg of
DNA, respectively) in the absence or presence of p85.
Both constructs
could associate with p85, as shown by anti-p85
immunoblotting of the
anti-myc and anti-GST immunoprecipitates
(Fig.
6A, bottom). When we measured the
specific activities of
C-myc-p110 and GST-p110, we found that the
specific activity of
C-myc-p110

in cells cotransfected with p85 was
increased 13-fold
relative to the activity of C-myc-p110

monomers
(Fig.
6B). In
contrast, the activity of GST-p110 was increased only
twofold
by coexpression with p85, relative to the activity of GST-p110
alone (Fig.
6B). Thus, p85 significantly increased the activity
of
C-myc-p110 but had only a small effect on GST-p110. These data
suggest
that both p85 and the GST N-terminal tag increase the
specific activity
of p110

by a similar mechanism. This mechanism
is unlikely to
involve a specific activating protein-protein interaction
and is more
likely to reflect a stabilization of the overall conformation
of
p110

. Although GST-p110 is already much more active than C-myc-p110,
the ability of p85 to increase its activity by an additional two
times
suggests that it is still not maximally stabilized. The
effect of p85
on an additionally stabilized GST-p110 is examined
below.

View larger version (27K):
[in this window]
[in a new window]
|
FIG. 6.
Effect of p85 on C-myc-p110 versus GST-p110 . HEK
293T cells were transfected with expression vectors for C-myc p110
or GST-p110 in the presence of a control vector or the expression
vector for p85. (A) Anti-myc or anti-GST immunoprecipitates (IP) were
blotted with anti-p110 antibody (top lanes) or anti-p85 antibody (lower
lanes). (B) Protein and lipid kinase activities in anti-myc or anti-GST
immunoprecipitates were calculated as described in the legend for Fig.
5A. The data are expressed as the fold stimulation for each construct
in the presence versus the absence of p85. All determinations were
performed in triplicate, and the data are the means ± standard
errors of the means from two separate experiments.
|
|
To directly test whether p85 stabilizes p110

in mammalian cells, we
examined the effect of p85 on the half-life of p110
in metabolically
labeled cells. HEK 293T cells were transfected
with C-myc-p110

in
the absence or presence of p85 and labeled
with
[
35S]methionine for 16 h. The cells were then chased
in medium containing
cold methionine for the indicated times, and
C-myc-p110

was immunoprecipitated
with anti-myc antibodies (Fig.
7). In the absence of p85, C-myc-p110
turned over with a half-life of approximately 1 h and was
completely
gone by 5 h. In contrast, C-myc-p110

/p85 dimers were
significantly
more stable, with an approximate half-life of 5 h.
We also found
that the half-life of GST-p110 in
[
35S]methionine-labeled cells was significantly greater
than that
of C-myc-p110 (data not shown). Thus, p110

was stabilized
by
dimerization with p85 or linkage to a bulky N-terminal tag.

View larger version (41K):
[in this window]
[in a new window]
|
FIG. 7.
Stabilization of p110 by p85 in mammalian cells. HEK
293T cells were transfected with vectors for C-myc-p110 in the absence
or presence of p85. Thirty-six hours after transfection the cells were
labeled with [35S]methionine overnight and then chased
for the indicated times in medium containing 10× methionine. The cells
were lysed, and immunoprecipitated p110 was separated by SDS-PAGE and
visualized by autoradiography. The data are representative of two
separate experiments.
|
|
Monomeric p110
is temperature sensitive in mammalian cells.
While these data suggest that the rescue of monomeric p110
activity
by p85 in mammalian cells reflects a stabilization of the catalytic
subunit, they do not explain why this is not observed when the proteins
are expressed in insect cells. We noted that a major difference between
mammalian and insect culture systems is the low temperature (27°C)
used for Sf-9 cells and reasoned that this might affect the stability
of a conformationally labile p110
monomer. We therefore compared the
activities of C-myc-p110
monomers in HEK 293T cells grown at 37 versus 30°C. Strikingly, the specific activity of C-myc-p110
in
HEK 293T cells was increased 15-fold by culture at 30°C (Fig.
8A), consistent with idea that monomeric
p110
is conformationally unstable.

View larger version (20K):
[in this window]
[in a new window]
|
FIG. 8.
Effect of temperature on the activity of p110 . (A)
HEK 293T cells were transfected with expression vectors for
C-myc-p110 and then maintained for 48 h at 37 or 30°C. The
cells were then lysed, and protein expression and lipid kinase
activities were determined as described in the legend for Fig. 5A. All
determinations were performed in triplicate, and the data are the
means ± standard errors of the means (SEM) from two
experiments. (B) Recombinant p110 or p85/p110 dimers were incubated at
the indicated temperatures for 30 min. After being chilled on ice, the
samples were assayed for lipid kinase activity at 22°C. The data are
the means ± SEM from three separate experiments.
|
|
The effect of p85 on thermal stability was examined in vitro by
producing p110

monomers and p85/p110

dimers in Sf-9 cells
and
then incubating them for 30 min at various temperatures prior
to assay
at 22°C (Fig.
8B). In the absence of p85, p110

was strikingly
sensitive to elevated temperatures and lost half its activity
after 30 min at 35°C. In contrast, the activity of p85/p110

was
minimally affected until temperatures reached 40°C or higher.
These data confirm the hypothesis that monomeric p110 is thermally
unstable and suggest that p85 increases the activity of p110
in
mammalian cells by stabilizing the catalytic subunit.
Inhibition of p110
by p85 in mammalian cells.
To further
reconcile the data derived from the insect and mammalian systems, we
sought to determine whether p85 acts as an inhibitor of p110
in
mammalian cells. To do this, it was necessary to experimentally
segregate the stabilizing effects of p85 from its potential inhibitory
effects. We therefore measured the activities of p110
and
p85/p110
under conditions designed to maximize the stability of the
p110
monomer. We transfected HEK 293T cells with the GST-p110
cDNA in the presence of empty vector or p85 expression plasmid, and
cultured the cells at 30°C. p85 immunoblots of anti-GST
immunoprecipitates demonstrated that p85 associated with GST-p110
in
cells grown at 30°C (data not shown). Interestingly, coexpression of
p85 with GST-p110 in HEK 293T cells caused a 50% decrease in the
specific activity of GST-p110, compared with the activity of GST-p110
alone (Fig. 9). This result is similar to the data obtained with recombinant baculovirus p110
(Fig. 1 and 2).
These data show that under conditions that optimize the stability of
monomeric p110
in mammalian cells, p85 inhibits p110
in a manner
similar to that seen in insect cells.

View larger version (16K):
[in this window]
[in a new window]
|
FIG. 9.
Inhibition of p110 by p85 in mammalian cells. HEK 293T
cells were transfected with GST-p110 in the presence of control
vector or p85 expression vector as indicated. After 48 h at
30°C, the cells were lysed and protein and lipid kinase activities
were determined. The activities were normalized to the activity of
GST-p110 . All determinations were performed in triplicate, and the
data are representative of four separate experiments.
|
|
 |
DISCUSSION |
Our data show that p85 has two distinct effects on the activity of
p110
. On the one hand, p85 binds to the N terminus of p110
and
inhibits the activity of the p110
monomer. This effect is clearly
seen under experimental conditions in which monomeric p110 is stable.
On the other hand, p85 stabilizes p110
. This effect is most clearly
seen in mammalian cells at 37°C, a temperature at which monomeric
p110
is unstable. The net activity of p110
in a given
experimental protocol reflects a balance between the inhibitory and
stabilizing effects of p85 on p110
.
With regard to the inhibitory effect, we show that the p85 regulatory
subunit of PI 3'-kinase decreases the activity of the p110
catalytic
subunit produced in Sf-9 cells. Given that the binding of p85 to
p110
is extremely stable (45), the basal state of a
p85/p110
dimer is inhibited relative to the activity of monomeric
p110
. This inhibition appears to be a direct result of dimerization
with p85, since it can be readily reconstituted in vitro and in fact
can be seen with p85 expressed in bacteria (data not shown). Similarly,
we find that inhibition of p110
by p85 is unaffected by mutation of
the Ser-608 inhibitory site of p85 or by dephosphorylation of p85 with
protein phosphatase 1. We have no information as to the level of
Ser-608 phosphorylation in p85 produced in Sf-9 cells and can make no
comment on potential additional roles for Ser-608 in the
regulation of p110
activity. However, the inhibition we record here
is clearly independent of p85 phosphorylation. Our results differ
from those of Woscholski et al., who reported that coexpression of p85
with p110 induced a phosphorylation-dependent 17-fold increase in the
Km for ATP (45). This increase was
only seen by using PI[4,5]P2 as a lipid substrate and was
not seen when p85 was reconstituted with p110
in vitro. These data
may reflect a different phenomenon than the one described in the
present study, since the inhibition we observe is clearly seen with PI,
PI[4]P, or PI[4,5]P2 and does not require the
coexpression of the two subunits.
We and others have previously shown that the activity of p85/p110
dimers is increased when the SH2 domains of p85 bind to phosphotyrosyl
proteins containing appropriate sequence motifs (2, 5). This
increase presumably reflects a conformational change induced by
phosphopeptide binding, since p85 remains bound to p110 in the presence
of phosphotyrosyl proteins (2). Our current data suggest
that the increased activity of p85/p110
heterodimers when bound to
phosphoproteins such as IRS-1 is not a true activation of p110
, but
rather a disinhibition of the p85/p110
heterodimer. Thus, activation
of p85/p110
dimers in mitogen-stimulated cells reflects a transition
between inhibited and disinhibited states. Using recombinant enzyme and
varying the concentration of either lipid or ATP, we find that
relative Vmax/Km values
for p85/p110
dimers are decreased by 60 to 85% compared to that
seen with monomeric p110
. The relative
Vmax/Km values for
p85/p110
dimers are increased by incubation with bisphosphorylated peptide, to within 75 to 95% of that seen with monomeric p110
. However, the activity of "activated" p85/p110
dimers never
exceeds that of an equivalent amount of monomeric p110
.
It is interesting to note that while inhibition of p110
by p85 was
seen by using PI, PI[4]P, or PI[4,5]P2 as the
substrate, the subsequent activation of the p85/p110
dimers by
phosphopeptides was less effective with PI[4,5]P2 as
a substrate than with the other lipids. In this regard, Rameh and
coworkers have noted that PI[3,4,5]P3 binds to the p85
SH2 domains and can compete with tyrosyl-phosphorylated IRS-1 for
p85 binding (30). Thus, it is possible that the in
vitro-produced PI[3,4,5]P3 competes with phosphopeptide for SH2 domain occupancy, reducing the resultant activation of p85/p110
dimers.
In contrast to our data obtained with recombinant enzyme produced in
Sf-9 cells, previous studies have shown that the activity of p110
is
significantly increased when the isoform is coexpressed with p85 in
mammalian cells (18), and attachment of the iSH2 domain to
p110 has been used to produce a constitutively active enzyme
(15). How can one reconcile this apparent activation of p110
by p85 in mammalian cells with the inhibition we observe in Sf-9 cells?
The explanation suggested by our data is that p110
is unstable as a
monomer at 37°C but can be stabilized by the binding of p85 to its N
terminus. Although the binding of p85 to p110
requires specific
interactions between the iSH2 domain of p85 and the N terminus of
p110
(12, 14, 19), the stabilization of p110
by p85
appears to be relatively nonspecific. It can be replaced by either
synthesis at low temperature or the attachment of a bulky N-terminal
tag. The ability of these nonspecific interventions to mimic the
effects of p85 suggest that the regulatory subunit acts by stabilizing
the overall conformation of the catalytic subunit, rather than by
inducing a specific activated conformation in p110
. This is
supported by the increased half-life of p85/p110
dimers as opposed
to p110
monomers in mammalian cells and by the finding that p85
protects p110
from thermal inactivation. Thus, the apparent
activation of p110
by p85 in mammalian cells at 37°C does not
reflect the difference between an enzyme in its basal and activated
states. Instead, it reflects the difference between a nonfunctional,
destabilized enzyme and an enzyme in its basal state.
Of the two effects of p85 on the activity of p110
, the stabilizing
effects are predominant when the activities of p110 monomers and
p85/p110 heterodimers in mammalian cells at 37°C are compared (a 15- to 20-fold difference). However, the stabilizing effects of p85 are
less impressive when the activity of monomeric GST-p110 is compared to
that of p85/GST-p110 in mammalian cells (a twofold difference). When
GST-p110 is further stabilized by growth of the cells at 30°C, we
find that the p110
catalytic subunit is maximally active as a
monomer and is inhibited 50% by dimerization with the p85 regulatory
subunit. This degree of inhibition is somewhat less than the 80%
inhibition we see with p110
from insect cells. The lesser degree of
inhibition could be due to interactions between p85 and additional
regulatory molecules present in HEK 293T cells. Alternatively, although
the conditions were designed to experimentally segregate the
stabilizing and inhibitory effects of p85, it is likely that p85 is
still somewhat stabilizing, even in mammalian cells at 30°C. This is
consistent with the finding that monomeric p110
loses activity after
30 min at 30°C in vitro. Attempts to culture HEK 293T cells at lower
temperatures were unsuccessful. Nonetheless, our data show that p85 has
qualitatively similar effects on p110
in mammalian and insect cells
under conditions that augment the stability of the p110
monomer.
Our data are not inconsistent with the data presented by Klippel et al.
and Hu et al., who showed that the activity of C-myc-tagged p110
was
rescued by either coexpression with the iSH2 domain of p85 or direct
linkage of the iSH2 domain to the N terminus of p110
(15,
18). The iSH2 domain of p85 presumably stabilizes monomeric
p110
in much the same way as p85, leading to an apparent activation
in mammalian cells at 37°C. The iSH2 domain does not, however, appear
to be a p110
activator, since binding of the recombinant iSH2 domain
to recombinant p110
in vitro has no effect on p110
activity
(46a). Similarly, the effects of a tethered iSH2 domain are
mimicked by a tethered GST moiety, suggesting that conformational
stability rather than specific activating interactions are involved.
In intact cells, the activity of p85/p110
dimers may also be
affected by their binding to GTP-bound ras and CDC42, SH3 domains from
Src family kinases, or proline-rich proteins that bind to the p85 SH3
domain (10, 28, 32, 47). It is not yet clear whether these
mechanisms of activation are distinct from activation via
phosphotyrosine-SH2 domain binding and whether they would lead to
levels of activity above that seen with monomeric p110
. Thus, it is
possible that activation of p85/p110
above the level of monomeric
p110
occurs in the more complex environment of the intact cell.
Moreover, an additional contribution to intracellular 3-phosphoinositide production would come from the targeting of p85/p110
to cell membranes. The ability of the p85 regulatory subunit to modulate p110
activity in response to these disparate inputs will be of great mechanistic interest for further studies.
 |
ACKNOWLEDGMENTS |
We thank Zhong-Yin Zhang and Steve Almo for numerous helpful
discussions. We thank Michael Waterfield for the p110
cDNA and Zhong-Yin Zhang for the recombinant PP1.
This work was supported by grants to J.M.B. from the American
Diabetes Association and National Institutes of Health grant GM55692.
J.M.B. is an Established Scientist of the American Heart Association,
New York Affiliate, and is a recipient of a Scholar Award from the Irma
T. Hirschl Trust. J.M. was supported by a fellowship from the Juvenile
Diabetes Foundation.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Department of
Molecular Pharmacology, Albert Einstein College of Medicine, 1300 Morris Park Ave., Bronx, NY 10461. Phone: (718) 430-2153. Fax: (718) 430-8922. E-mail: Backer{at}AECOM.yu.edu.
 |
REFERENCES |
| 1.
|
Antonetti, D. A.,
P. Algenstaedt, and C. R. Kahn.
1996.
Insulin receptor substrate 1 binds two novel splice variants of the regulatory subunit of phosphatidylinositol 3-kinase in muscle and brain.
Mol. Cell. Biol.
16:2195-2203[Abstract].
|
| 2.
|
Backer, J. M., Jr.,
M. G. Myers,
S. E. Shoelson,
D. J. Chin,
X. J. Sun,
M. Miralpeix,
P. Hu,
B. Margolis,
E. Y. Skolnik,
J. Schlessinger, and M. F. White.
1992.
The phosphatidylinositol 3'-kinase is activated by association with IRS-1 during insulin stimulation.
EMBO J.
11:3469-3479[Medline].
|
| 3.
|
Booker, G. W.,
I. Gout,
A. K. Downing,
P. C. Driscoll,
J. Boyd,
M. D. Waterfield, and I. D. Campbell.
1993.
Solution structure and ligand-binding site of the SH3 domain of the p85 subunit of phosphatidylinositol 3-kinase.
Cell
73:813-822[Medline].
|
| 4.
|
Cantley, L. C.,
K. R. Auger,
C. Carpenter,
B. Duckworth,
A. Graziani,
R. Kapeller, and S. Soltoff.
1991.
Oncogenes and signal transduction.
Cell
64:231-302.
|
| 5.
|
Carpenter, C. L.,
K. R. Auger,
M. Chanudhuri,
M. Yoakim,
B. Schaffhausen,
S. Shoelson, and L. C. Cantley.
1993.
Phosphoinositide 3-kinase is activated by phosphopeptides that bind to the SH2 domains of the 85-kDa subunit.
J. Biol. Chem.
268:9478-9483[Abstract/Free Full Text].
|
| 6.
|
Cheatham, B.,
C. J. Vlahos,
L. Cheatham,
L. Wang,
J. Blenis, and C. R. Kahn.
1994.
Phosphatidylinositol 3-kinase activation is required for insulin stimulation of pp70 S6 kinase, DNA synthesis, and glucose transporter translocation.
Mol. Cell. Biol.
14:4902-4911[Abstract/Free Full Text].
|
| 7.
|
Dhand, R.,
K. Hara,
I. Hiles,
B. Bax,
I. Gout,
G. Panayotou,
M. J. Fry,
K. Yonezawa,
M. Kasuga, and M. D. Waterfield.
1994.
PI 3-kinase: structural and functional analysis of intersubunit interactions.
EMBO J.
13:511-521[Medline].
|
| 8.
|
Dhand, R.,
I. Hiles,
G. Panayotou,
S. Roche,
M. J. Fry,
I. Gout,
N. F. Totty,
O. Truong,
P. Vicendo,
K. Yonezawa,
M. Kasuga,
S. A. Courtneidge, and M. D. Waterfield.
1994.
PI 3-kinase is a dual specificity enzyme: autoregulation by an intrinsic protein-serine kinase activity.
EMBO J.
13:522-533[Medline].
|
| 9.
|
Escobedo, J. A.,
S. Navankasattusas,
W. M. Kavanaugh,
D. Milfay,
V. A. Fried, and L. T. Williams.
1991.
cDNA cloning of a novel 85 kD protein that has SH2 domains and regulates binding of PI3-kinase to the PDGF -receptor.
Cell
65:75-82[Medline].
|
| 10.
|
Guinebault, C.,
B. Payrastre,
C. Racaud-Sultan,
H. Mazarguil,
M. Breton,
G. Mauco,
M. Plantavid, and H. Chap.
1995.
Integrin-dependent translocation of phosphoinositide 3-kinase to the cytoskeleton of thrombin-activated platelets involves specific interactions of p85- with actin filaments and focal adhesion kinase.
J. Cell Biol.
129:831-842[Abstract/Free Full Text].
|
| 11.
|
Hiles, I. D.,
M. Otsu,
S. Volinia,
M. J. Fry,
I. Gout,
R. Dhand,
G. Panayotou,
F. Ruiz-Larrea,
A. Thompson,
N. F. Totty,
J. J. Hsuan,
S. A. Courtneidge,
P. J. Parker, and M. D. Waterfield.
1992.
Phosphatidylinositol 3-kinase: structure and expression of the 110 kd catalytic subunit.
Cell
70:419-429[Medline].
|
| 12.
|
Holt, K. H.,
A. L. Olson,
W. S. Moye-Rowley, and J. E. Pessin.
1994.
Phosphatidylinositol 3-kinase activation is mediated by high-affinity interactions between distinct domains within the p110 and p85 subunits.
Mol. Cell. Biol.
14:42-49[Abstract/Free Full Text].
|
| 13.
|
Hu, P.,
A. Mondino,
E. Y. Skolnik, and J. Schlessinger.
1993.
Cloning of a novel, ubiquitously expressed human phosphatidylinositol 3-kinase and identification of its binding site on p85.
Mol. Cell. Biol.
13:7677-7688[Abstract/Free Full Text].
|
| 14.
|
Hu, P., and J. Schlessinger.
1994.
Direct association of p110 phosphatidylinositol 3-kinase with p85 is mediated by an N-terminal fragment of p110 .
Mol. Cell. Biol.
14:2577-2583[Abstract/Free Full Text].
|
| 15.
|
Hu, Q.,
A. Klippel,
A. J. Muslin,
W. J. Fantl, and L. T. Williams.
1995.
Ras-dependent induction of cellular responses by constitutively active phosphatidylinositol-3 kinase.
Science
268:100-102[Abstract/Free Full Text].
|
| 16.
|
Joly, M.,
A. Kazlauskas, and S. Corvera.
1995.
Phosphatidylinositol 3-kinase activity is required at a postendocytic step in platelet-derived growth factor receptor trafficking.
J. Biol. Chem.
270:13225-13230[Abstract/Free Full Text].
|
| 17.
|
Kapeller, R.,
K. V. S. Prasad,
O. Janssen,
W. Hou,
B. S. Schaffhausen,
C. E. Rudd, and L. C. Cantley.
1994.
Identification of two SH3-binding motifs in the regulatory subunit of phosphatidylinositol 3-kinase.
J. Biol. Chem.
269:1927-1933[Abstract/Free Full Text].
|
| 18.
|
Klippel, A.,
J. A. Escobedo,
M. Hirano, and L. T. Williams.
1994.
The interaction of small domains between the subunits of phosphatidylinositol 3-kinase determines enzyme activity.
Mol. Cell. Biol.
14:2675-2685[Abstract/Free Full Text].
|
| 19.
|
Klippel, A.,
J. A. Escobedo,
Q. Hu, and L. T. Williams.
1993.
A region of the 85-kilodalton (kDa) subunit of phosphatidylinositol 3-kinase binds the 110-kDa catalytic subunit in vivo.
Mol. Cell. Biol.
13:5560-5566[Abstract/Free Full Text].
|
| 20.
|
Kotani, K.,
K. Yonezawa,
K. Hara,
H. Ueda,
Y. Kitamura,
H. Sakaue,
A. Ando,
A. Chavanieu,
B. Calas,
F. Grigorescu,
M. Nishiyama,
M. D. Waterfield, and M. Kasuga.
1994.
Involvement of phosphoinositide 3-kinase in insulin- or IGF-1-induced membrane ruffling.
EMBO J.
13:2313-2321[Medline].
|
| 21.
|
Kozak, M.
1986.
Point mutations define a sequence flanking the AUG initiator codon that modulates translation by eukaryotic ribosomes.
Cell
44:283-292[Medline].
|
| 22.
|
Kozak, M.
1997.
Recognition of AUG and alternative initiator codons is augmented by G in position +4 but is not generally affected by the nucleotides in positions +5 and +6.
EMBO J.
16:2482-2492[Medline].
|
| 23.
|
Kunkel, T. A.,
J. D. Roberts, and R. A. Zakour.
1987.
Rapid and efficient site-specific mutagenesis without phenotypic selection.
Methods Enzymol.
154:367-382[Medline].
|
| 24.
|
Leevers, S. J.,
D. Weinkove,
L. K. MacDougall,
E. Hafen, and M. D. Waterfield.
1996.
The Drosophila phosphoinositide 3-kinase Dp110 promotes cell growth.
EMBO J.
15:6584-6594[Medline].
|
| 25.
|
McIlroy, J.,
D. Chen,
C. Wjasow,
T. Michaeli, and J. M. Backer.
1997.
Specific activation of p85-p110 phosphatidylinositol 3'-kinase stimulates DNA synthesis by ras- and p70 S6 kinase-dependent pathways.
Mol. Cell. Biol.
17:248-255[Abstract].
|
| 26.
|
Molz, L.,
Y. W. Chen,
M. Hirano, and L. T. Williams.
1996.
Cpk is a novel class of Drosophila PtdIns 3-kinase containing a C2 domain.
J. Biol. Chem.
271:13892-13899[Abstract/Free Full Text].
|
| 27.
|
Otsu, M.,
I. Hiles,
I. Gout,
M. J. Fry,
F. Ruiz-Larrea,
G. Panayotou,
A. Thompson,
R. Dhand,
J. Hsuan,
N. Totty,
A. D. Smith,
S. J. Morgan,
S. A. Courtneidge,
P. J. Parker, and M. D. Waterfield.
1991.
Characterization of two 85 kD proteins that associate with receptor tyrosine kinases, middle-T/pp60c-src complexes and PI3-kinase.
Cell
65:91-104[Medline].
|
| 28.
|
Pleiman, C. M.,
W. M. Hertz, and J. C. Cambier.
1994.
Activation of phosphatidylinositol-3' kinase by Src-family kinase SH3 binding to the p85 subunit.
Science
263:1609-1612[Abstract/Free Full Text].
|
| 29.
|
Pons, S.,
T. Asano,
E. Glasheen,
M. Miralpeix,
Y. Zhang,
T. L. Fisher,
M. G. Myers, Jr.,
X. J. Sun, and M. F. White.
1995.
The structure and function of p55PIK reveal a new regulatory subunit for phosphatidylinositol 3-kinase.
Mol. Cell. Biol.
15:4453-4465[Abstract].
|
| 30.
|
Rameh, L. E.,
C.-S. Chen, and L. C. Cantley.
1995.
Phosphatidylinositol (3,4,5)P3 interacts with SH2 domains and modulates PI 3-kinase association with tyrosine-phosphorylated proteins.
Cell
83:821-830[Medline].
|
| 31.
|
Roche, S.,
M. Koegl, and S. A. Courtneidge.
1994.
The phosphatidylinositol 3-kinase is required for DNA synthesis induced by some, but not all, growth factors.
Proc. Natl. Acad. Sci. USA
91:9185-9189[Abstract/Free Full Text].
|
| 32.
|
Rodriguez-Viciana, P.,
P. H. Warne,
B. Vanhaesebroeck,
M. D. Waterfield, and J. Downward.
1996.
Activation of phosphoinositide 3-kinase by interaction with Ras and by point mutation.
EMBO J.
15:2442-2451[Medline].
|
| 33.
|
Rordorf-Nikolic, T.,
D. J. Van Horn,
D. Chen,
M. F. White, and J. M. Backer.
1995.
Regulation of phosphatidylinositol 3'-kinase by tyrosyl phosphoproteins. Full activation requires occupancy of both SH2 domains in the 85-kDa regulatory subunit.
J. Biol. Chem.
270:3662-3666[Abstract/Free Full Text].
|
| 34.
|
Ruderman, N.,
R. Kapeller,
M. F. White, and L. C. Cantley.
1990.
Activation of phosphatidylinositol-3-kinase by insulin.
Proc. Natl. Acad. Sci. USA
87:1411-1415[Abstract/Free Full Text].
|
| 35.
|
Schu, P. V.,
K. Takegawa,
M. J. Fry,
J. H. Stack,
M. D. Waterfield, and S. D. Emr.
1993.
Phosphatidylinositol 3-kinase encoded by yeast VPS34 gene essential for protein sorting.
Science
260:88-91[Abstract/Free Full Text].
|
| 36.
|
Skolnik, E. Y.,
B. Margolis,
M. Mohammadi,
E. Lowenstein,
R. Fischer,
A. Drepps,
A. Ullrich, and J. Schlessinger.
1991.
Cloning of PI3 kinase-associated p85 utilizing a novel method for expression/cloning of target proteins for receptor tyrosine kinases.
Cell
65:83-90[Medline].
|
| 37.
|
Songyang, Z.,
S. E. Shoelson,
M. Chaudhuri,
G. Gish,
T. Pawson,
W. G. Haser,
F. King,
T. Roberts,
S. Ratnofsky,
R. J. Lechleider,
B. G. Neel,
R. B. Birge,
J. E. Fajardo,
M. M. Chou,
H. Hanafusa,
B. Schaffhausen, and L. C. Cantley.
1993.
SH2 domains recognize specific phosphopeptide sequences.
Cell
72:767-778[Medline].
|
| 38.
|
Stephens, L. R.,
A. Eguinoa,
H. Erdjument-Bromage,
M. Lui,
F. Cooke,
J. Coadwell,
A. S. Smrcka,
M. Thelen,
K. Cadwallader,
P. Tempst, and P. T. Hawkins.
1997.
The G gamma sensitivity of a PI3K is dependent upon a tightly associated adaptor, p101.
Cell
89:105-114[Medline].
|
| 39.
|
Stoyanov, B.,
S. Volinia,
T. Hanck,
I. Rubio,
M. Loubtchenkov,
D. Malek,
S. Stoyanova,
B. Vanhaesebroeck,
R. Dhand,
B. Nurnberg,
P. Gierschik,
K. Seedorf,
J. J. Hsuan,
M. D. Waterfield, and R. Wetzker.
1995.
Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase.
Science
269:690-693[Abstract/Free Full Text].
|
| 40.
|
Sun, X. J.,
P. Rothenberg,
C. R. Kahn,
J. M. Backer,
E. Araki,
P. A. Wilden,
D. A. Cahill,
B. J. Goldstein, and M. F. White.
1991.
The structure of the insulin receptor substrate IRS-1 defines a unique signal transduction protein.
Nature
352:73-77[Medline].
|
| 41.
|
Tolias, K. F.,
L. C. Cantley, and C. L. Carpenter.
1995.
Rho family GTPases bind to phosphoinositide kinases.
J. Biol. Chem.
270:17656-17659[Abstract/Free Full Text].
|
| 42.
|
Vanhaesebroeck, B.,
M. J. Welham,
K. Kotani,
R. Stein,
P. H. Warne,
M. J. Zvelebil,
K. Higashi,
S. Volinia,
J. Downward, and M. D. Waterfield.
1997.
p110-delta, a novel phosphoinositide 3-kinase in leukocytes.
Proc. Natl. Acad. Sci. USA
94:4330-4335[Abstract/Free Full Text].
|
| 43.
|
Virbasius, J. V.,
A. Guilherme, and M. P. Czech.
1996.
Mouse p170 is a novel phosphatidylinositol 3-kinase containing a C2 domain.
J. Biol. Chem.
271:13304-13307[Abstract/Free Full Text].
|
| 44.
|
Volinia, S.,
R. Dhand,
B. Vanhaesebroeck,
L. K. MacDougall,
R. Stein,
M. J. Zvelebil,
J. Domin,
C. Panaretou, and M. D. Waterfield.
1995.
A human phosphatidylinositol 3-kinase complex related to the yeast Vps34p-Vps15p protein sorting system.
EMBO J.
14:3339-3348[Medline].
|
| 45.
|
Woscholski, R.,
R. Dhand,
M. J. Fry,
M. D. Waterfield, and P. J. Parker.
1994.
Biochemical characterization of the free catalytic p110 and the complexed heterodimeric p110 · p85 forms of the mammalian phosphatidylinositol 3-kinase.
J. Biol. Chem.
269:25067-25072[Abstract/Free Full Text].
|
| 46.
|
Yao, R., and G. M. Cooper.
1995.
Requirement for phosphatidylinositol-3 kinase in the prevention of apoptosis by nerve growth factor.
Science
267:2003-2006[Abstract/Free Full Text].
|
| 46a.
| Yu, J., and J. M. Backer. Unpublished data.
|
| 47.
|
Zheng, Y.,
S. Bagrodia, and R. A. Cerione.
1994.
Activation of phosphoinositide 3-kinase by Cdc42Hs binding to p85.
J. Biol. Chem.
269:18727-18730[Abstract/Free Full Text].
|
| 48.
|
Zvelebil, M. J.,
L. MacDougall,
S. Leevers,
S. Volinia,
B. Vanhaesebroeck,
I. Gout,
G. Panayotou,
J. Domin,
R. Stein,
F. Pages,
F. Hoga,
K. Salim,
J. Linacre,
P. Das,
C. Panaretou,
R. Wetzker, and M. Waterfield.
1996.
Structural and functional diversity of phosphoinositide 3-kinases.
Philos. Trans. R. Soc. Lond.
351:217-223[Medline].
|
Mol Cell Biol, March 1998, p. 1379-1387, Vol. 18, No. 3
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Adhikari, D., Liu, K.
(2009). Molecular Mechanisms Underlying the Activation of Mammalian Primordial Follicles. Endocr. Rev.
30: 438-464
[Abstract]
[Full Text]
-
Martin-Fernandez, C., Bales, J., Hodgkinson, C., Welman, A., Welham, M. J., Dive, C., Morrow, C. J.
(2009). Blocking Phosphoinositide 3-Kinase Activity in Colorectal Cancer Cells Reduces Proliferation but Does Not Increase Apoptosis Alone or in Combination with Cytotoxic Drugs. Mol Cancer Res
7: 955-965
[Abstract]
[Full Text]
-
Alcazar, I., Cortes, I., Zaballos, A., Hernandez, C., Fruman, D. A., Barber, D. F., Carrera, A. C.
(2009). p85{beta} phosphoinositide 3-kinase regulates CD28 coreceptor function. Blood
113: 3198-3208
[Abstract]
[Full Text]
-
Rigor, D. L., Bodyak, N., Bae, S., Choi, J. H., Zhang, L., Ter-Ovanesyan, D., He, Z., McMullen, J. R., Shioi, T., Izumo, S., King, G. L., Kang, P. M.
(2009). Phosphoinositide 3-kinase Akt signaling pathway interacts with protein kinase C{beta}2 in the regulation of physiologic developmental hypertrophy and heart function. Am. J. Physiol. Heart Circ. Physiol.
296: H566-H572
[Abstract]
[Full Text]
-
Boulay, P.-L., Cotton, M., Melancon, P., Claing, A.
(2008). ADP-ribosylation Factor 1 Controls the Activation of the Phosphatidylinositol 3-Kinase Pathway to Regulate Epidermal Growth Factor-dependent Growth and Migration of Breast Cancer Cells. J. Biol. Chem.
283: 36425-36434
[Abstract]
[Full Text]
-
Serra, V., Markman, B., Scaltriti, M., Eichhorn, P. J.A., Valero, V., Guzman, M., Botero, M. L., Llonch, E., Atzori, F., Di Cosimo, S., Maira, M., Garcia-Echeverria, C., Parra, J. L., Arribas, J., Baselga, J.
(2008). NVP-BEZ235, a Dual PI3K/mTOR Inhibitor, Prevents PI3K Signaling and Inhibits the Growth of Cancer Cells with Activating PI3K Mutations. Cancer Res.
68: 8022-8030
[Abstract]
[Full Text]
-
Li, Y., Anderson, D. H., Liu, Q., Zhou, Y.
(2008). Mechanism of Influenza A Virus NS1 Protein Interaction with the p85{beta}, but Not the p85{alpha}, Subunit of Phosphatidylinositol 3-Kinase (PI3K) and Up-regulation of PI3K Activity. J. Biol. Chem.
283: 23397-23409
[Abstract]
[Full Text]
-
Fos, C., Salles, A., Lang, V., Carrette, F., Audebert, S., Pastor, S., Ghiotto, M., Olive, D., Bismuth, G., Nunes, J. A.
(2008). ICOS Ligation Recruits the p50{alpha} PI3K Regulatory Subunit to the Immunological Synapse. J. Immunol.
181: 1969-1977
[Abstract]
[Full Text]
-
Yuan, T. L., Choi, H. S., Matsui, A., Benes, C., Lifshits, E., Luo, J., Frangioni, J. V., Cantley, L. C.
(2008). Class 1A PI3K regulates vessel integrity during development and tumorigenesis. Proc. Natl. Acad. Sci. USA
105: 9739-9744
[Abstract]
[Full Text]
-
Zhao, L., Vogt, P. K.
(2008). Helical domain and kinase domain mutations in p110{alpha} of phosphatidylinositol 3-kinase induce gain of function by different mechanisms. Proc. Natl. Acad. Sci. USA
105: 2652-2657
[Abstract]
[Full Text]
-
Hale, B. G., Batty, I. H., Downes, C. P., Randall, R. E.
(2008). Binding of Influenza A Virus NS1 Protein to the Inter-SH2 Domain of p85 Suggests a Novel Mechanism for Phosphoinositide 3-Kinase Activation. J. Biol. Chem.
283: 1372-1380
[Abstract]
[Full Text]
-
Janas, M. L., Hodson, D., Stamataki, Z., Hill, S., Welch, K., Gambardella, L., Trotman, L. C., Pandolfi, P. P., Vigorito, E., Turner, M.
(2008). The Effect of Deleting p110{delta} on the Phenotype and Function of PTEN-Deficient B Cells. J. Immunol.
180: 739-746
[Abstract]
[Full Text]
-
Masia, S., Alvarez, S., de Lera, A. R., Barettino, D.
(2007). Rapid, Nongenomic Actions of Retinoic Acid on Phosphatidylinositol-3-Kinase Signaling Pathway Mediated by the Retinoic Acid Receptor. Mol. Endocrinol.
21: 2391-2402
[Abstract]
[Full Text]
-
Yip, S.-C., El-Sibai, M., Coniglio, S. J., Mouneimne, G., Eddy, R. J., Drees, B. E., Neilsen, P. O., Goswami, S., Symons, M., Condeelis, J. S., Backer, J. M.
(2007). The distinct roles of Ras and Rac in PI 3-kinase-dependent protrusion during EGF-stimulated cell migration. J. Cell Sci.
120: 3138-3146
[Abstract]
[Full Text]
-
Hirsch, E., Costa, C., Ciraolo, E.
(2007). Phosphoinositide 3-kinases as a common platform for multi-hormone signaling. J Endocrinol
194: 243-256
[Abstract]
[Full Text]
-
Miled, N., Yan, Y., Hon, W.-C., Perisic, O., Zvelebil, M., Inbar, Y., Schneidman-Duhovny, D., Wolfson, H. J., Backer, J. M., Williams, R. L.
(2007). Mechanism of Two Classes of Cancer Mutations in the Phosphoinositide 3-Kinase Catalytic Subunit. Science
317: 239-242
[Abstract]
[Full Text]
-
Younes, H., Leleu, X., Hatjiharissi, E., Moreau, A.-S., Hideshima, T., Richardson, P., Anderson, K. C., Ghobrial, I. M.
(2007). Targeting the Phosphatidylinositol 3-Kinase Pathway in Multiple Myeloma. Clin. Cancer Res.
13: 3771-3775
[Abstract]
[Full Text]
-
Walker, V. G., Ammer, A., Cao, Z., Clump, A. C., Jiang, B.-H., Kelley, L. C., Weed, S. A., Zot, H., Flynn, D. C.
(2007). PI3K activation is required for PMA-directed activation of cSrc by AFAP-110. Am. J. Physiol. Cell Physiol.
293: C119-C132
[Abstract]
[Full Text]
-
Geering, B., Cutillas, P. R., Nock, G., Gharbi, S. I., Vanhaesebroeck, B.
(2007). Class IA phosphoinositide 3-kinases are obligate p85-p110 heterodimers. Proc. Natl. Acad. Sci. USA
104: 7809-7814
[Abstract]
[Full Text]
-
Deane, J. A., Kharas, M. G., Oak, J. S., Stiles, L. N., Luo, J., Moore, T. I., Ji, H., Rommel, C., Cantley, L. C., Lane, T. E., Fruman, D. A.
(2007). T-cell function is partially maintained in the absence of class IA phosphoinositide 3-kinase signaling. Blood
109: 2894-2902
[Abstract]
[Full Text]
-
Taniguchi, C. M., Tran, T. T., Kondo, T., Luo, J., Ueki, K., Cantley, L. C., Kahn, C. R.
(2006). Phosphoinositide 3-kinase regulatory subunit p85{alpha} suppresses insulin action via positive regulation of PTEN. Proc. Natl. Acad. Sci. USA
103: 12093-12097
[Abstract]
[Full Text]
-
Riley, J. K, Moley, K. H
(2006). Glucose utilization and the PI3-K pathway: mechanisms for cell survival in preimplantation embryos.. Reproduction
131: 823-835
[Abstract]
[Full Text]
-
Hazeki, K., Kinoshita, S., Matsumura, T., Nigorikawa, K., Kubo, H., Hazeki, O.
(2006). Opposite Effects of Wortmannin and 2-(4-Morpholinyl)-8-phenyl-1(4H)-benzopyran-4-one Hydrochloride on Toll-Like Receptor-Mediated Nitric Oxide Production: Negative Regulation of Nuclear Factor-{kappa}B by Phosphoinositide 3-Kinase. Mol. Pharmacol.
69: 1717-1724
[Abstract]
[Full Text]
-
Peloponese, J.-M. Jr., Jeang, K.-T.
(2006). Role for Akt/Protein Kinase B and Activator Protein-1 in Cellular Proliferation Induced by the Human T-cell Leukemia Virus Type 1 Tax Oncoprotein. J. Biol. Chem.
281: 8927-8938
[Abstract]
[Full Text]
-
Theodoropoulou, M., Zhang, J., Laupheimer, S., Paez-Pereda, M., Erneux, C., Florio, T., Pagotto, U., Stalla, G. K.
(2006). Octreotide, a Somatostatin Analogue, Mediates Its Antiproliferative Action in Pituitary Tumor Cells by Altering Phosphatidylinositol 3-Kinase Signaling and Inducing Zac1 Expression. Cancer Res.
66: 1576-1582
[Abstract]
[Full Text]
-
Kang, S., Denley, A., Vanhaesebroeck, B., Vogt, P. K.
(2006). Oncogenic transformation induced by the p110beta, -{gamma}, and -{delta} isoforms of class I phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA
103: 1289-1294
[Abstract]
[Full Text]
-
Zhao, J. J., Liu, Z., Wang, L., Shin, E., Loda, M. F., Roberts, T. M.
(2005). The oncogenic properties of mutant p110{alpha} and p110{beta} phosphatidylinositol 3-kinases in human mammary epithelial cells. Proc. Natl. Acad. Sci. USA
102: 18443-18448
[Abstract]
[Full Text]
-
Luo, J., McMullen, J. R., Sobkiw, C. L., Zhang, L., Dorfman, A. L., Sherwood, M. C., Logsdon, M. N., Horner, J. W., DePinho, R. A., Izumo, S., Cantley, L. C.
(2005). Class IA Phosphoinositide 3-Kinase Regulates Heart Size and Physiological Cardiac Hypertrophy. Mol. Cell. Biol.
25: 9491-9502
[Abstract]
[Full Text]
-
Yee, M.-c., Fas, S. C., Stohlmeyer, M. M., Wandless, T. J., Cimprich, K. A.
(2005). A Cell-permeable, Activity-based Probe for Protein and Lipid Kinases. J. Biol. Chem.
280: 29053-29059
[Abstract]
[Full Text]
-
Luo, J., Field, S. J., Lee, J. Y., Engelman, J. A., Cantley, L. C.
(2005). The p85 regulatory subunit of phosphoinositide 3-kinase down-regulates IRS-1 signaling via the formation of a sequestration complex. JCB
170: 455-464
[Abstract]
[Full Text]
-
Shekar, S. C., Wu, H., Fu, Z., Yip, S.-C., Nagajyothi, , Cahill, S. M., Girvin, M. E., Backer, J. M.
(2005). Mechanism of Constitutive Phosphoinositide 3-Kinase Activation by Oncogenic Mutants of the p85 Regulatory Subunit. J. Biol. Chem.
280: 27850-27855
[Abstract]
[Full Text]
-
Luo, J., Sobkiw, C. L., Logsdon, N. M., Watt, J. M., Signoretti, S., O'Connell, F., Shin, E., Shim, Y., Pao, L., Neel, B. G., DePinho, R. A., Loda, M., Cantley, L. C.
(2005). Modulation of epithelial neoplasia and lymphoid hyperplasia in PTEN+/- mice by the p85 regulatory subunits of phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA
102: 10238-10243
[Abstract]
[Full Text]
-
Ikenoue, T., Kanai, F., Hikiba, Y., Obata, T., Tanaka, Y., Imamura, J., Ohta, M., Jazag, A., Guleng, B., Tateishi, K., Asaoka, Y., Matsumura, M., Kawabe, T., Omata, M.
(2005). Functional Analysis of PIK3CA Gene Mutations in Human Colorectal Cancer. Cancer Res.
65: 4562-4567
[Abstract]
[Full Text]
-
Brachmann, S. M., Yballe, C. M., Innocenti, M., Deane, J. A., Fruman, D. A., Thomas, S. M., Cantley, L. C.
(2005). Role of Phosphoinositide 3-Kinase Regulatory Isoforms in Development and Actin Rearrangement. Mol. Cell. Biol.
25: 2593-2606
[Abstract]
[Full Text]
-
Brachmann, S. M., Ueki, K., Engelman, J. A., Kahn, R. C., Cantley, L. C.
(2005). Phosphoinositide 3-Kinase Catalytic Subunit Deletion and Regulatory Subunit Deletion Have Opposite Effects on Insulin Sensitivity in Mice. Mol. Cell. Biol.
25: 1596-1607
[Abstract]
[Full Text]
-
Voigt, P., Brock, C., Nurnberg, B., Schaefer, M.
(2005). Assigning Functional Domains within the p101 Regulatory Subunit of Phosphoinositide 3-Kinase {gamma}. J. Biol. Chem.
280: 5121-5127
[Abstract]
[Full Text]
-
Barbee, S. D., Alberola-Ila, J.
(2005). Phosphatidylinositol 3-Kinase Regulates Thymic Exit. J. Immunol.
174: 1230-1238
[Abstract]
[Full Text]
-
Chua, J., Deretic, V.
(2004). Mycobacterium tuberculosis Reprograms Waves of Phosphatidylinositol 3-Phosphate on Phagosomal Organelles. J. Biol. Chem.
279: 36982-36992
[Abstract]
[Full Text]
-
Kharas, M. G., Deane, J. A., Wong, S., O'Bosky, K. R., Rosenberg, N., Witte, O. N., Fruman, D. A.
(2004). Phosphoinositide 3-kinase signaling is essential for ABL oncogene-mediated transformation of B-lineage cells. Blood
103: 4268-4275
[Abstract]
[Full Text]
-
Foukas, L. C., Panayotou, G., Shepherd, P. R.
(2004). Direct Interaction of Major Histocompatibility Complex Class II-derived Peptides with Class Ia Phosphoinositide 3-Kinase Results in Dose-dependent Stimulatory Effects. J. Biol. Chem.
279: 7505-7511
[Abstract]
[Full Text]
-
Chen, D., Mauvais-Jarvis, F., Bluher, M., Fisher, S. J., Jozsi, A., Goodyear, L. J., Ueki, K., Kahn, C. R.
(2004). p50{alpha}/p55{alpha} Phosphoinositide 3-Kinase Knockout Mice Exhibit Enhanced Insulin Sensitivity. Mol. Cell. Biol.
24: 320-329
[Abstract]
[Full Text]
-
Ueki, K., Fruman, D. A., Yballe, C. M., Fasshauer, M., Klein, J., Asano, T., Cantley, L. C., Kahn, C. R.
(2003). Positive and Negative Roles of p85{alpha} and p85{beta} Regulatory Subunits of Phosphoinositide 3-Kinase in Insulin Signaling. J. Biol. Chem.
278: 48453-48466
[Abstract]
[Full Text]
-
Lu, Y., Yu, Q., Liu, J. H., Zhang, J., Wang, H., Koul, D., McMurray, J. S., Fang, X., Yung, W.K. A., Siminovitch, K. A., Mills, G. B.
(2003). Src Family Protein-tyrosine Kinases Alter the Function of PTEN to Regulate Phosphatidylinositol 3-Kinase/AKT Cascades. J. Biol. Chem.
278: 40057-40066
[Abstract]
[Full Text]
-
Riggins, R. B., DeBerry, R. M., Toosarvandani, M. D., Bouton, A. H.
(2003). Src-Dependent Association of Cas and p85 Phosphatidylinositol 3'-Kinase in v-crk-Transformed Cells. Mol Cancer Res
1: 428-437
[Abstract]
[Full Text]
-
Fu, Z., Aronoff-Spencer, E., Backer, J. M., Gerfen, G. J.
(2003). From the Cover: The structure of the inter-SH2 domain of class IA phosphoinositide 3-kinase determined by site-directed spin labeling EPR and homology modeling. Proc. Natl. Acad. Sci. USA
100: 3275-3280
[Abstract]
[Full Text]
-
Hallmann, D., Trumper, K., Trusheim, H., Ueki, K., Kahn, C. R., Cantley, L. C., Fruman, D. A., Horsch, D.
(2003). Altered Signaling and Cell Cycle Regulation in Embryonal Stem Cells with a Disruption of the Gene for Phosphoinositide 3-Kinase Regulatory Subunit p85alpha. J. Biol. Chem.
278: 5099-5108
[Abstract]
[Full Text]
-
Brock, C., Schaefer, M., Reusch, H. P., Czupalla, C., Michalke, M., Spicher, K., Schultz, G., Nurnberg, B.
(2003). Roles of G{beta}{gamma} in membrane recruitment and activation of p110{gamma}/p101 phosphoinositide 3-kinase {gamma}. JCB
160: 89-99
[Abstract]
[Full Text]
-
Jimenez, C., Hernandez, C., Pimentel, B., Carrera, A. C.
(2002). The p85 Regulatory Subunit Controls Sequential Activation of Phosphoinositide 3-Kinase by Tyr Kinases and Ras. J. Biol. Chem.
277: 41556-41562
[Abstract]
[Full Text]
-
Ueki, K., Fruman, D. A., Brachmann, S. M., Tseng, Y.-H., Cantley, L. C., Kahn, C. R.
(2002). Molecular Balance between the Regulatory and Catalytic Subunits of Phosphoinositide 3-Kinase Regulates Cell Signaling and Survival. Mol. Cell. Biol.
22: 965-977
[Abstract]
[Full Text]
-
von Gise, A., Lorenz, P., Wellbrock, C., Hemmings, B., Berberich-Siebelt, F., Rapp, U. R., Troppmair, J.
(2001). Apoptosis Suppression by Raf-1 and MEK1 Requires MEK- and Phosphatidylinositol 3-Kinase-Dependent Signals. Mol. Cell. Biol.
21: 2324-2336
[Abstract]
[Full Text]
-
Ueki, K., Algenstaedt, P., Mauvais-Jarvis, F., Kahn, C. R.
(2000). Positive and Negative Regulation of Phosphoinositide 3-Kinase-Dependent Signaling Pathways by Three Different Gene Products of the p85alpha Regulatory Subunit. Mol. Cell. Biol.
20: 8035-8046
[Abstract]
[Full Text]
-
Arcaro, A., Zvelebil, M. J., Wallasch, C., Ullrich, A., Waterfield, M. D., Domin, J.
(2000). Class II Phosphoinositide 3-Kinases Are Downstream Targets of Activated Polypeptide Growth Factor Receptors. Mol. Cell. Biol.
20: 3817-3830
[Abstract]
[Full Text]
-
Lu-Kuo, J. M., Fruman, D. A., Joyal, D. M., Cantley, L. C., Katz, H. R.
(2000). Impaired Kit- but Not Fcepsilon RI-initiated Mast Cell Activation in the Absence of Phosphoinositide 3-Kinase p85alpha Gene Products. J. Biol. Chem.
275: 6022-6029
[Abstract]
[Full Text]
-
Aoki, M., Schetter, C., Himly, M., Batista, O., Chang, H. W., Vogt, P. K.
(2000). The Catalytic Subunit of Phosphoinositide 3-Kinase: Requirements for Oncogenicity. J. Biol. Chem.
275: 6267-6275
[Abstract]
[Full Text]
-
Hill, K., Welti, S., Yu, J., Murray, J. T., Yip, S.-C., Condeelis, J. S., Segall, J. E., Backer, J. M.
(2000). Specific Requirement for the p85-p110alpha Phosphatidylinositol 3-Kinase during Epidermal Growth Factor-stimulated Actin Nucleation in Breast Cancer Cells. J. Biol. Chem.
275: 3741-3744
[Abstract]
[Full Text]
-
Beitz, L. O., Fruman, D. A., Kurosaki, T., Cantley, L. C., Scharenberg, A. M.
(1999). SYK Is Upstream of Phosphoinositide 3-Kinase in B Cell Receptor Signaling. J. Biol. Chem.
274: 32662-32666
[Abstract]
[Full Text]
-
Maier, U., Babich, A., Nurnberg, B.
(1999). Roles of Non-catalytic Subunits in Gbeta gamma -induced Activation of Class I Phosphoinositide 3-Kinase Isoforms beta and gamma. J. Biol. Chem.
274: 29311-29317
[Abstract]
[Full Text]
-
Tiganis, T., Kemp, B. E., Tonks, N. K.
(1999). The Protein-tyrosine Phosphatase TCPTP Regulates Epidermal Growth Factor Receptor-mediated and Phosphatidylinositol 3-Kinase-dependent Signaling. J. Biol. Chem.
274: 27768-27775
[Abstract]
[Full Text]
-
Krugmann, S., Hawkins, P. T., Pryer, N., Braselmann, S.
(1999). Characterizing the Interactions between the Two Subunits of the p101/p110gamma Phosphoinositide 3-Kinase and Their Role in the Activation of This Enzyme by Gbeta gamma Subunits. J. Biol. Chem.
274: 17152-17158
[Abstract]
[Full Text]
-
Harpur, A. G., Layton, M. J., Das, P., Bottomley, M. J., Panayotou, G., Driscoll, P. C., Waterfield, M. D.
(1999). Intermolecular Interactions of the p85alpha Regulatory Subunit of Phosphatidylinositol 3-Kinase. J. Biol. Chem.
274: 12323-12332
[Abstract]
[Full Text]
-
Bi, L., Okabe, I., Bernard, D. J., Wynshaw-Boris, A., Nussbaum, R. L.
(1999). Proliferative Defect and Embryonic Lethality in Mice Homozygous for a Deletion in the p110alpha Subunit of Phosphoinositide 3-Kinase. J. Biol. Chem.
274: 10963-10968
[Abstract]
[Full Text]
-
Hunter, S., Burton, E. A., Wu, S. C., Anderson, S. M.
(1999). Fyn Associates with Cbl and Phosphorylates Tyrosine 731 in Cbl, A Binding Site for Phosphatidylinositol 3-Kinase. J. Biol. Chem.
274: 2097-2106
[Abstract]
[Full Text]
-
Fruman, D. A., Snapper, S. B., Yballe, C. M., Davidson, L., Yu, J. Y., Alt, F. W., Cantley, L. C.
(1999). Impaired B Cell Development and Proliferation in Absence of Phosphoinositide 3-Kinase p85. Science
283: 393-397
[Abstract]
[Full Text]
-
Siddhanta, U., McIlroy, J., Shah, A., Zhang, Y., Backer, J. M.
(1998). Distinct Roles for the p110{alpha} and hVPS34 Phosphatidylinositol 3'-Kinases in Vesicular Trafficking, Regulation of the Actin Cytoskeleton, and Mitogenesis. JCB
143: 1647-1659
[Abstract]
[Full Text]
-
Layton, M. J., Harpur, A. G., Panayotou, G., Bastiaens, P. I. H., Waterfield, M. D.
(1998). Binding of a Diphosphotyrosine-containing Peptide That Mimics Activated Platelet-derived Growth Factor Receptor beta Induces Oligomerization of Phosphatidylinositol 3-Kinase. J. Biol. Chem.
273: 33379-33385
[Abstract]
[Full Text]
-
Yu, J., Wjasow, C., Backer, J. M.
(1998). Regulation of the p85/p110alpha Phosphatidylinositol 3'-Kinase. DISTINCT ROLES FOR THE N-TERMINAL AND C-TERMINAL SH2 DOMAINS. J. Biol. Chem.
273: 30199-30203
[Abstract]
[Full Text]
-
Cuevas, B. D., Lu, Y., Mao, M., Zhang, J., LaPushin, R., Siminovitch, K., Mills, G. B.
(2001). Tyrosine Phosphorylation of p85 Relieves Its Inhibitory Activity on Phosphatidylinositol 3-Kinase. J. Biol. Chem.
276: 27455-27461
[Abstract]
[Full Text]
-
Gonzalez-Garcia, A., Garrido, E., Hernandez, C., Alvarez, B., Jimenez, C., Cantrell, D. A., Pullen, N., Carrera, A. C.
(2002). A New Role for the p85-Phosphatidylinositol 3-Kinase Regulatory Subunit Linking FRAP to p70 S6 Kinase Activation. J. Biol. Chem.
277: 1500-1508
[Abstract]
[Full Text]
-
Seykora, J. T., Mei, L., Dotto, G. P., Stein, P. L.
(2002). `Srcasm: a Novel SrcActivating and Signaling Molecule. J. Biol. Chem.
277: 2812-2822
[Abstract]
[Full Text]
-
Ueki, K., Yballe, C. M., Brachmann, S. M., Vicent, D., Watt, J. M., Kahn, C. R., Cantley, L. C.
(2002). Increased insulin sensitivity in mice lacking p85beta subunit of phosphoinositide 3-kinase. Proc. Natl. Acad. Sci. USA
99: 419-424
[Abstract]
[Full Text]