Previous Article | Next Article 
Mol Cell Biol, May 1998, p. 2650-2658, Vol. 18, No. 5
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
Two Distinct Domains in Staf To Selectively
Activate Small Nuclear RNA-Type and mRNA Promoters
Catherine
Schuster,
Alain
Krol, and
Philippe
Carbon*
UPR 9002 du CNRS "Structure des
Macromolécules Biologiques et Mécanismes de
Reconnaissance," IBMC, 67084 Strasbourg Cedex, France
Received 16 October 1997/Returned for modification 24 November
1997/Accepted 17 February 1998
 |
ABSTRACT |
Staf is a transcriptional activator of prime importance for
enhanced transcription of small nuclear (snRNA) and snRNA-type genes
transcribed by RNA polymerases II and III (Pol II and III). In addition
to this activity, it also possesses the capacity to stimulate
expression from an RNA polymerase II mRNA promoter. This
promiscuous activator thus provides a useful model system for studying
the mechanism by which one single transcription factor can
activate a large variety of promoters. Here, we report the use of in
vivo assays to identify the Staf activation domains involved in
promoter selectivity. Analysis of Staf mutants reveals the existence of
two physically and functionally distinct regions, outside of the DNA
binding domain, responsible for mediating selective transcriptional
activation. While a 93-amino-acid domain, with the striking presence of
four repeated units, is specialized for transcriptional activation of
an mRNA promoter, a segment of only 18 amino acids, with a critical
Leu-213 residue, acts specifically on Pol II and Pol III snRNA and
snRNA-type promoters. In addition, this study disclosed the
fundamental importance of invariant leucine and aspartic acid residues
located in each repeat unit of the mRNA activation domain. Staf is
therefore the first transcriptional activator described so far
to harbor two physically and functionally distinct activator domains.
This finding suggests that the same activator can contact different,
specialized transcription complexes formed on different types of basal
promoters through promoter-specific transactivation pathways.
 |
INTRODUCTION |
Transcriptional activation in
eukaryotes is achieved by regulatory proteins recruiting the
transcriptional machinery and chromatin remodeling factors to the
promoter. Transcriptional activators have been shown to present a
modular organization consisting of distinct domains for
sequence-specific DNA binding and transcriptional activation through
interaction with other proteins (for a review, see reference
34). DNA binding domains of many
transactivators fall into readily identifiable classes. Instead,
domains responsible for transcriptional activity may not possess such a
well-defined organization. While no obvious sequence similarity
has been detected among the activation domains of diverse
activator proteins, they nevertheless often carry a distinctive amino
acid composition. For example, activation domains particularly rich
either in prolines, glutamines, acidic amino acids, or hydroxylated
amino acids have been described (for reviews, see references
4, 21, 27, and 51). Despite the
identification of targets for numerous activation domains and
elucidation of the functional importance of particular residues, the
structural basis for the capacity of an activation domain to stimulate
transcription remains poorly understood. However, recent structural
studies suggest that the
-helix may be a common structural motif in
the binding of transactivation factors to transcriptional activation
factors (22, 52).
Transcriptional activators were also described to stimulate
transcription of RNA polymerases II (Pol II) and III (Pol III) small nuclear RNA (snRNA) genes. In vertebrates, these genes
contain an essential proximal sequence element (PSE) located at
approximately the position
59 upstream of the transcription start
site. The Pol III-dependent promoters possess additionally a TATA box
located at position
30, which acts as a major determinant for RNA Pol III specificity (24, 26; for a review, see reference
15). A number of other short transcription units,
such as the 7SK, Y, MRP, selenocysteine tRNA (tRNASec), and
H1 RNA genes, have similar basal promoter elements and can be
classified as snRNA-type genes (3, 30; for a review, see reference 14). These will be here referred to as
snRNA-type promoters. SNAPc, also called PTF, is a stable complex
containing four protein subunits. It binds specifically to the PSE
(13, 31, 37, 54, 55). Other studies have also implicated the TATA binding protein (TBP), TFIIIC1, and TFIIIB
in transcription of
Pol III snRNA genes (25, 41, 48, 55).
Associated with the basal promoter, the snRNA and snRNA-type
genes contain a distal sequence element (DSE) around
position
220, which plays a major role in transcription
efficiency. The DSE contains an octamer motif which binds
the transcriptional activator Oct-1
(42; for reviews, see references
14 and 16). In addition to Oct-1,
Sp1 has been shown in some instances to be involved in mediating the
activation properties of the DSE (1, 20, 23, 47). Recently,
we have demonstrated that the zinc finger protein Staf, originally
identified as the transcriptional activator of the tRNASec
gene (39), is also involved in transcriptional activation of snRNA and snRNA-type genes transcribed by RNA polymerases II and III
(38). In the course of previous investigations, we observed that Staf also possesses the ability to stimulate CAT expression from a
Pol II promoter (32, 39), therefore showing that it can
activate a whole diversity of Pol II and Pol III promoters. At first
sight, this result might be surprising in view of the fact that,
although transcription of mRNA and Pol II snRNA genes is catalyzed by
the same enzyme, the architectures of mRNA and snRNA transcription
complexes have some dissimilarities (for reviews, see references
14 and 15). So far, the mechanism
by which Staf can interact with these different Pol II and Pol III
transcription complexes has remained unknown. In order to gain insight
into it, the mapping and functional dissection of the Staf activation domain was undertaken. We report here that Staf contains in fact two
distinct snRNA and mRNA promoter-specific activation domains, explaining why a single transcriptional activator can activate a
variety of different promoters. This finding lays the foundation for
further elucidation of the detailed, promoter-specific activation pathways.
 |
MATERIALS AND METHODS |
Effector constructs.
Staf-Krox-20
473 to 600 (SK
473-600), the Staf-Krox-20 3'-end-truncated derivative, was
obtained by double digestion of pBRN3-Staf-Krox-20 (39)
with EcoRV (cleavage at position 1443 of the Staf cDNA sequence) and NotI (cleavage in the polylinker of pBRN3) and
recircularization of the plasmid after filling-in of the
NotI 5' extremity. Staf-Krox-20
6-248 (SK
6-248), the
Staf-Krox-20 5'-end-truncated derivative, was obtained by digestion of
pBRN3-Staf-Krox-20 with NcoI (cleaved at positions 138 and 771 of the Staf cDNA sequence) and recircularization of the
filled-in ends of the shortened plasmid. Internal deletions
6-77,
6-102,
6-130,
6-206,
6-220,
78-220,
157-220,
6-206+
225-242,
84-176,
244-262, and
212-220 in
Staf-Krox-20
473-600, truncation
212-220 in Staf-Krox-20,
and mutants PDTIS207-211AAAAA, SIEG221-224AAAA, E214A+Q215A+K219A, L213A+Y216A, S211A, L213A, E214A, Q215A,
Y216A, and K219A in Staf-Krox-20
473-600 were obtained by
site-directed mutagenesis of the parental vector. S84-176K contains the
two internal deletions,
6-78 and
177-262, obtained by
site-directed mutagenesis of the parental vector.
S207-224K was obtained as follows. A polylinker created by
annealing the oligonucleotides
5'GATCTTCTAGAGCCGCCACCATGGCATCGATCCCGGGAAGACACACCAAGGATCCAGATCTGC3' and
5'CATGGCAGATCT GGATCCTTGGTGTGTCTTCCCGGGATCGATGCCATGGTGGCGGCTC TAGAA3'
was inserted into pBRN3-Krox-20-DBD cleaved at the BglII and NcoI sites (39). This creates E83. A 64-bp
BbsI fragment (containing Pro 207 to Gly 224 of Staf),
obtained by PCR amplification using the 5' and 3' primers complementary
to positions 646 to 663 and 679 to 700 of the Staf cDNA sequence,
was inserted into the BbsI-cleaved E83 construct. The
5'CTGAAGACACACCACCCCGACACAATCAGCGCA and
3'CTGAAGACTGTGGTCTCCTTCAATCGACACCTTTGC primers incorporated the BbsI sites. The sequence of the N-terminal part of
the S207-224K protein upstream of the Krox-20-DBD is
MASIPGKTHHPDTISALEQYAAKVSIEGDGGSRSAM (in bold, the
Staf sequence from residues 207 to 224).
Deletion mutations in pPac-Staf (
39) were obtained as
follows.
BamHI sites were introduced by site-directed
mutagenesis
of pBRN3-Staf (
39) at positions 156 and 1839 of
the Staf cDNA
sequence to create pBRN3-Staf-BB. Deletions

6-248,

473-600,

84-176,

212-220,

77-102,

77-130,

77-156,

77-220,

103-220,

131-220, and

157-220 and mutants
D168A+G169A+T170A, L166A, D168A,
and T170A were created by
site-directed mutagenesis of pBRN3-Staf-BB.
The
BamHI
fragments encoding the Staf mutants were excised from
the mutated
pBRN3-Staf-BB and introduced clockwise at the
BamHI
site
into plasmid pPac to generate the series of pPac-Staf
expression
constructs for transfection into
Drosophila SL2
cells.
Reporter constructs.
p6E.tkCAT, AE.tkCAT,
3E.tRNASec, and 3E.U1 are described in references
53, 32, 39, and 38, respectively.
Oocyte microinjections, nuclear localization, and DNA
binding assays.
Capped mRNAs were synthesized in vitro by T3
RNA polymerase as described in Schuster et al. (39)
and were injected (20 nl, 1 ng) into the cytoplasm of
Xenopus laevis oocytes, 20 h before nuclear injection
of 20 nl containing the reporter. The concentrations of the
reporters were 300 µg/ml for 6E.tkCAT and 50 µg/ml for 3E.tRNASec and 3E.U1. The 3E.tRNASec and 3E.U1
reporters were injected in the presence of [
-32P]GTP
(800 Ci/mmol, 0.2 µCi/oocyte) and 5S RNA maxigene (5 µg/ml) as an
internal control for nuclear microinjection and RNA recovery. The
6E.tkCAT reporter was injected in the presence of the pCH110 vector
(300 µg/ml) as an internal control for nuclear injection. Incubation
was for 16 h (3E.U1 and 6E.tkCAT reporters) or 3 h (3E.tRNASec reporter). Transcription of the reporter genes
was analyzed as described previously (32, 39). The
transcription efficiencies of the tRNASec and U1 RNA genes,
relative to the 5S RNA maxigene expression, were quantitated with a
Fuji Bioimage Analyzer BAS2000. For monitoring synthesis and nuclear
localization of the effector proteins, oocytes microinjected with mRNAs
were manually enucleated. Oocyte nuclei were homogenized in 8 µl of
the extraction buffer [50 mM Tris-HCl (pH 8.0), 50 mM KCl, 0.1 mM
EDTA, 5 mM MgCl2, 25% glycerol, 1 µl of bestatin per ml,
1 µl of pepstatin A per ml, 1 µl of
trans-epoxysuccinyl-L-leucylamido-(4-guanidino)-butane per ml, 1 µl of 4-(2 aminoethyl)-benzenesulfonyl fluoride per ml]
per nucleus. Homogenates were clarified by centrifugation at 13,000 rpm
for 5 min. 32P-labeled double-stranded oligonucleotides
containing the E element were used for Staf-Krox-20 and Krox-20-DBD
bandshift assays as described previously (6).
Transfections, CAT assays, and Western analysis.
Schneider
line 2 (SL2) Drosophila cells were transfected by the
DOTAP liposomal transfection procedure (Boehringer). The cells received
500 ng of expression plasmid, 500 ng of reporter plasmid, and 200 ng of
pACH110 (49).
-Galactosidase activity, normalization, and
chloramphenicol acetyl-transferase (CAT) assays were performed as
described previously (39). Results were quantitated with a
Fuji Bioimage Analyzer BAS2000. The data represent the averages of
results from three to four transfections, each performed in duplicate.
For Western blot analysis, extracts from
Drosophila-transfected cells were prepared essentially as
described previously (2). Proteins were transferred to
nitrocellulose and visualized with a polyclonal serum raised against a
C-terminal Staf peptide with the use of ECL reagents (Amersham).
 |
RESULTS |
Mapping of the Staf activation domain.
The Staf amino acid
sequence can be divided into three regions (Fig.
1A): an N-terminal domain (amino acids 1 to 263), which we refer to as domain A; a central DNA binding domain B
containing seven zinc fingers of the C2-H2 type
(amino acids 264 to 468); and the C-terminal domain C (amino acids 469 to 600). Truncated Staf proteins were constructed, in order to define
the Staf domains which are needed for the activation of snRNA,
snRNA-type, and TATA box-containing mRNA promoters. The transactivation
capabilities provided by the wild-type and truncated proteins
(Fig. 1A) was assayed on various promoters by microinjection into
X. laevis oocytes. To eliminate the background provided by
the endogenous Staf in this assay, we designed chimeric
Staf-Krox-20 proteins with altered DNA binding specificities. The Staf
zinc finger domain was replaced by the corresponding
sequences of the Krox-20 zinc finger domain (K-DBD), as
illustrated in Fig. 1A (5, 39). This results in chimeric
Staf-Krox-20 molecules (Fig. 1A) with different DNA binding
specificities but overall structures that are likely to be relatively
unchanged from that of the wild-type protein. The abilities of the
different Staf-Krox-20 chimeric proteins to activate snRNA and
snRNA-type promoters were assayed with Xenopus U1b1 snRNA
(Pol II) and tRNASec (Pol III) promoters. They contained,
in place of the residing activator element, a multimerized version of
the Krox-20 binding site E element (3E.U1 and 3E.tRNASec)
(Fig. 1A). The reporter 6E.tkCAT (Fig. 1A), containing six E elements upstream of the tk promoter, was used for
monitoring the transcriptional activation on TATA box-containing mRNA
promoters (53).

View larger version (18K):
[in this window]
[in a new window]

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 1.
The Staf-Krox-20 chimera requires the N terminus to
activate transcription from tk.CAT, U1 snRNA, and tRNASec
promoters. (A) Schematic diagrams depicting the effector mRNAs
synthesized in vitro and the 6E.tkCAT, 3E.U1 and 3E.tRNASec
reporter genes used in the Xenopus microinjection assay. The
first lane shows the structure of Staf. The A, B, and C domains are
indicated with their localizations. PSE and TATA correspond to the
basal promoter elements of the U1 and tRNASec genes. 3E and
6E indicate the number of multimerized E binding sites of the
Krox-20 protein. SK, chimeric Staf-Krox-20 molecules. (B) CAT assays
showing transcriptional activation from the 6E.tkCAT promoter by the
K-DBD, SK, SK 473-600 and SK 6-248 effectors using extracts from
microinjected Xenopus oocytes. Lane 1, no effector was
expressed. (C) Transcriptional activation from the Pol
II 3E.U1 (lanes 1 to 4) and Pol III 3E.tRNASec (lanes
5 to 8) promoters by the SK, SK 473-600 and SK 6-248 effectors
using microinjected Xenopus oocytes. Lanes 1 and 5, no
effector was expressed. Positions of the U1, tRNASec, and
5S maxi used as an internal standard are indicated. (D) Effector
expression assayed by gel retardation with nuclear extracts from
microinjected Xenopus oocytes. The identity of the expressed effector
is indicated above each lane. Lanes 1 and 2, no effector was expressed.
Reactions in lanes 1, 3, 5, 7, and 9 ( ) contained no competitor;
lanes 2, 4, 6, 8, and 10 (+) contained a 100-fold molar excess of
unlabeled E competitor DNA.
|
|
The mRNAs of the various Staf-Krox-20 effectors were transcribed
in vitro, capped, and injected separately into the oocyte
cytoplasm (
39). Twenty hours postinjection, the
6E.tkCAT, 3E.tRNA
Sec, and 3E.U1 reporters were
injected separately into oocyte nuclei.
3E.U1 and
3E.tRNA
Sec were injected along with
[

-
32P]GTP and a plasmid containing a 5S RNA maxigene
as an internal
standard. After a second incubation, the labeled
RNAs were extracted
and the transcription levels of the U1 snRNA
and tRNA
Sec genes, normalized relative to the 5S RNA
maxigene expression,
were used to measure the transactivation
properties of the protein
tested. For experiments with the
mRNA promoter, a plasmid containing
the

-galactosidase
gene, not responding to Staf, served as an
internal control and was
coinjected with the 6E.tkCAT reporter
into oocyte nuclei. After a
second incubation, protein extracts
were prepared and the
normalized CAT activity was used as a measure
of the
transactivation properties. In the presence of Staf-Krox-20
(SK), the transcription levels of 6E.tkCAT, 3E.U1 and
3E.tRNA
Sec were significantly enhanced (compare lanes 1 and
3 in Fig.
1B
and lanes 1 and 2 and 5 and 6 in Fig.
1C). With
SK

473-600, a
Staf-Krox-20 derivative lacking the C-terminal
domain C, a comparable
level of activation was obtained (compare lanes
3 and 4 in Fig.
1B and lanes 2 and 3 and 6 and 7 in Fig.
1C). This
effect is not
mediated by Krox-20-DBD, since transcription of the
6E.tkCAT,
3E.U1, and 3E.tRNA
Sec reporters was not
enhanced by the presence of this protein containing
only the
DNA-binding domain (Fig.
1B, lane 2) (
38,
39). In
contrast, removal of the N-terminal amino acids 6 to
248 in SK

6-248,
resulted in the complete loss of enhanced
transcriptional activity
for the three reporters (compare lanes 3 and 5 in Fig.
1B and
lanes 2 and 4 and 6 and 8 in Fig.
1C). Note that
for lane 4, the
normalized value for the U1 transcription level is
very similar
to that obtained in lane 1, taking into account that the
intensity
of the 5S maxigene internal control is higher in lane 4 than in
lane 1.
The quantity, quality, and nuclear localization of the effector
proteins were assayed by gel retardation assays with oocyte
nuclear extracts and a
32P-labeled oligonucleotide probe
containing one Krox-20 E site
(Fig.
1D). Competition experiments
revealed the specificity of
the shifted complexes since an excess of
unlabeled E site competed
efficiently with their formation (Fig.
1D).
The relative mobilities
of the different complexes indicated that
full-length effector
proteins were expressed in these microinjections.
Quantitation
of the shifted complexes showed that the relative binding
efficiencies
of the chimeric proteins SK

473-600 and
SK

6-248 in the oocyte
nuclear extracts are 10-fold higher than that
of SK (Fig.
1D).
However, these binding efficiencies were not used to
correct the
activation levels, since titration experiments
showed that the
levels of the effector proteins are saturating in our
assays;
therefore, a 10-fold increase or decrease in the mRNA
concentration
of the effector will not change the level of
transcriptional activation
(data not shown).
Taken together, these results indicate that the N terminus of Staf
(domain A) is necessary and sufficient for maximal transactivation
of
Pol II and Pol III snRNA and snRNA-type promoters and TATA
box-containing mRNA promoters.
The minimal activation domain for snRNA-type promoters is 18 amino
acids long.
To define the minimal region of Staf sufficient for
activation of snRNA and snRNA-type promoters by RNA polymerases II and III, the 263-amino-acid activation domain A was subdivided by creating
a series of deletion mutants on Staf-Krox-20
473-600 (Fig.
2A). These fusion proteins were again
tested for their ability to activate transcription of the
3E.tRNASec and 3E.U1 reporters in a microinjection
assay. Internal deletions between amino acid 5 and amino acids 78 (
6-77), 103 (
6-102), 131 (
6-130), and 207 (
6-206) did not
impair activation of the Pol III tRNASec and Pol II U1
promoters (Fig. 2B, compare lane 1 and lanes 2 to 5 for the
tRNASec promoter; and lanes 2 and 5 for the U1 promoter in
Fig. 2C). In contrast, when the internal deletions included amino acids 207 to 220 in the
6-220,
78-220, and
157-220 mutants,
activation of transcription was lost (Fig. 2B, lanes 6 to 8; Fig. 2C,
compare lane 2 with lanes 3 and 4). The
6-206 truncation, associated with a deletion between amino acids 224 and 243 (
6-206+
225-242), as well as the deletion between amino acids 243 and 263 (
244-262), led to a protein as active as the parental Staf-Krox-20 (Fig. 2B,
compare lane 11 with lanes 12 and 13; Fig. 2C, compare lane 2 with lanes 6 and 7). This truncation analysis demonstrates that the
region from 207 to 224 is critical for activation of the
tRNASec and U1 promoters.

View larger version (25K):
[in this window]
[in a new window]

View larger version (26K):
[in this window]
[in a new window]

View larger version (39K):
[in this window]
[in a new window]
|
FIG. 2.
Characterization of the minimal activation domain for
Pol II and Pol III snRNA promoters. (A) Schematic structures of the
various truncated and fused Staf-Krox-20 proteins. The Krox-20 DBD is
hatched. (B) Xenopus microinjection assay of transcriptional
activation from the 3E.tRNASec promoter by the effectors
depicted in panel A. Identities of the effector proteins are indicated
above each lane. Lanes 9, 10, and 19, assays without effector ( ).
Positions of the 5S maxigene and tRNASec RNAs are
indicated. Autoradiographs corresponding to lanes 1 to 9, 10 to 15, 16 to 18, and 19 to 20 were from separate experiments. (C)
Xenopus microinjection assay of transcriptional activation
from the 3E.U1 promoter by the effectors depicted in panel A. Positions
of the U1 and 5S maxi RNAs are indicated. Lane 1, assay without
effector ( ).
|
|
The importance of domain 207 to 224 was further established by
examining the effects of deletions within this defined area.
Deletions
of amino acids 212 to 220 in Staf-Krox-20 (

212-220)
and Staf-Krox-20

473-600 (

212-220+

473-600) (Fig.
2A) abolished
the
transactivation abilities of these effector proteins (Fig.
2B, compare
lanes 11 and 15 and lanes 17 and 18; Fig.
2C, compare
lane 8 with lanes
9 and 10). Lastly, fusion of the 18-amino-acid
domain 207 to 224 to
Krox-20 DBD produced protein S207-224K (Fig.
2A) which carried the
ability to activate transcription of the
tRNA
Sec (Fig.
2B,
compare lanes 19 and 20) and U1 promoters (Fig.
2C,
compare lanes 1, 8, and 13). The expression levels and nuclear
localization of these
chimera were verified by electrophoretic
mobility shift assays using
nuclear extracts from oocytes injected
with mRNAs (data not shown).
These results show clearly that the 18-amino-acid region 207 to 224 of
sequence PDTISALEQYAAKVSIEG represents the minimal
Staf activation
domain for Pol III tRNA
Sec and Pol II U1 promoters.
Leu-213 is critical for transactivation activity on snRNA-type
promoters.
The region 207 to 224 does not have a preponderance of
amino acids, such as glutamines, isoleucines, prolines, or
serines-threonines that typify other well-characterized activation
domains. To determine residues responsible for activation, mutants were
created by alanine substitution mutagenesis in the context of
Staf-Krox-20
473-600. Alanine substitutions of amino acids 207 to
211, 221 to 224, and serine 211 (Fig.
3A, PDTIS207-211AAAAA,
SIEG221-224AAAA, and S211A, respectively) had a very minor or no
effect at all on the ability of the protein to activate the
3E.tRNASec and 3E.U1 reporters in the Xenopus
microinjection assay (Fig. 3B). Replacement of the three residues at
positions 214, 215, and 219 (Fig. 3A, E214A+Q215A+K219A) produced a
twofold drop in the activity of the protein. In stark contrast, the
simultaneous replacement of the two residues at positions 213 and 216 by an alanine L213A+Y216A (Fig. 3A) completely abolished the
transactivating ability of the protein (Fig. 3B). To assess the
contributions of Leu-213, Glu-214, Gln-215, Tyr-216, and Lys-219, they
were individually mutated to alanines. Whereas changing Glu-214,
Gln-215, Tyr-216, and Lys-219 had only a moderate effect, the L213A
mutant by itself was severely defective compared to Staf-Krox-20
473-600 (Fig. 3B).

View larger version (24K):
[in this window]
[in a new window]
|
FIG. 3.
Identification of amino acids essential for
transactivation of snRNA and snRNA-type promoters. (A) The amino acid
sequence of the Staf domain 207 to 224 is shown with the changes
introduced in the mutants. Dots in the mutant sequences indicate an
unchanged residue. (B) Transcriptional activation assays from the Pol
II 3E.U1 and Pol III 3E.tRNASec promoters by the various
effectors depicted in panel A. Activity is shown as a percentage of the
activity observed with Staf-Krox-20 473-600 construct containing the
wild-type snRNA activation domain. Activities in microinjections
assays with the 3E.U1 and 3E.tRNASec reporters are
shown by solid and shaded bars, respectively. Results are the averages
of two independent determinations. Identities of the effector proteins
are indicated below each histogram. , assay without effector.
|
|
These results demonstrate that Leu-213 is essential to the activity of
the Staf snRNA transactivation domain.
Staf contains distinct activation domains for mRNA and snRNA-type
promoters.
To determine if the snRNA activation domain of Staf can
also activate transcription from an mRNA promoter, we tested the
ability of truncated Staf-Krox-20 proteins to enhance the transcription level of the 6E.tkCAT reporter in a microinjection assay. Surprisingly, deletion of residues 212 to 220 in Staf-Krox-20 (
212-220) and Staf-Krox-20
473-600 (
212-220+
473-600), corresponding to
sequence ALEQYAAKV, had no effect on the
transcription level of 6E.tkCAT, while the same mutant
effectors failed to activate snRNA-type promoters (Fig.
4, compare lane 2 with lanes 3 and 5). In
sharp contrast, deletion of residues 84 to 176 (
84-176+
473-600;
Fig. 2A) in Staf-Krox-20
473-600 completely abolished activation
from the thymidine kinase (tk) promoter of 6E.tkCAT (Fig. 4,
compare lanes 2 and 4) but is absolutely innocuous to activation of
transcription from the tRNASec and U1 promoters (Fig. 2B,
lanes 11 and 14; Fig. 2C, lanes 8 and 11). This analysis
indicated that a region containing residues 84 to 176 is the
major contributor to activation of transcription from an mRNA promoter.
A fusion of the region containing residues 84 to 176 to the Krox-20
DBD, to yield S84-176K (Fig. 2A), led to efficient activation of
transcription from 6E.tkCAT (Fig. 4, compare lanes 2 and 6). However,
this same chimeric protein was unable to activate snRNA and snRNA-type
promoters (Fig. 2B, lanes 16 and 17; Fig. 2C, lanes 8 and 12).
Therefore, this 93-amino-acid region appears to possess an autonomous
transactivation capability in the absence of the rest of Staf.

View larger version (41K):
[in this window]
[in a new window]
|
FIG. 4.
The mRNA activation domain is distinct from the
snRNA counterpart. Representative CAT assays of transcriptional
activation from the 6E.tkCAT promoter using extracts from
microinjected Xenopus oocytes. Identities of the effectors
are indicated above the lanes. The effector structures are depicted in
Fig. 2A. Expression of the proteins was confirmed by gel mobility shift
assays using nuclear extracts from microinjected Xenopus
oocytes (data not shown).
|
|
Together, these results demonstrate unambiguously that Staf
contains two physically separate and functionally distinct
activation
domains located in the N terminus of the molecule. The
activation
domain covering residues 207 to 224 functions
solely in the transactivation
of Pol II and Pol III
snRNA-type promoters. The other activation
domain,
encompassing amino acids 84 to 176, is restricted to transcriptional
activation from mRNA promoters.
Four repeat units for an mRNA activation domain.
So far, our
investigations were carried out with the use of chimeric Stafs bearing
the Krox-20 DBD. To obviate the need for this heterologous DBD, which
was required to eliminate the endogenous Staf background of the
Xenopus oocytes, another strategy was taken. Drosophila cells, which were shown not to possess a Staf
activity, were employed (39). In these cell lines, we could
assay only the mRNA activation domain since the literature provides
experimental evidence that transcriptional activation of snRNA
promoters in Drosophila does not proceed similarly to that
in vertebrates (8). Full-length Staf or various deletion
mutant versions were expressed under the control of the constitutively
active actin 5C promoter (Fig. 5A).
The reporter AE.tkCAT contains three Staf binding site AE upstream
of the tk promoter fused to the CAT reporter gene. Cotransfection of wild-type Staf and reporter plasmid resulted in an
efficient transcriptional activation of the CAT gene (Fig. 5B, compare
lanes 1 and 2). Deletions of the C-terminal domain C and of amino acids
212 to 220 (Staf
473-600 and Staf
212-220, respectively) (Fig.
5A) did not reduce the ability of Staf to activate the tk
promoter (Fig. 5B, compare lane 2 with lanes 4 and 5). In contrast,
however, deletion of the N-terminal domain A or an internal deletion
between amino acids 83 and 177 (Staf
6-248 and Staf
84-176,
respectively) (Fig. 5A) produced molecules which were unable to
stimulate the promoter of the CAT reporter gene (Fig. 5B, compare lane
2 with lanes 3 and 6). The transcriptional activity could be fully
recovered with Staf 84-176 (Fig. 5A), a fusion protein consisting of
only amino acids 84 to 176 fused to the Staf DBD (Fig. 5B, compare
lanes 2 and 7). These results, obtained with Drosophila
cells, corroborate those already obtained with the
Xenopus oocyte system with chimeric Staf-Krox-20 proteins.

View larger version (25K):
[in this window]
[in a new window]
|
FIG. 5.
Transactivation abilities of Staf deletion mutants from
an mRNA promoter, assayed in Drosophila cells. (A) Schematic
structures of the various Staf deletion mutants. The A, B, and C
domains of Staf are indicated. The Staf DNA binding domain is
represented in black. (B) Representative CAT assays using extracts from
Drosophila cells transfected with the effectors indicated
above each lane.
|
|
The 93-amino-acid region (84 to 176) of Staf, which can
activate an mRNA promoter as an independent transactivating domain,
contains four short repeats of 15 amino acids, with the consensus
sequence QAVQLEDG(S/T)TAYI(Q/H)H. The distance between
each repeat
is 10 to 12 amino acids. The positions of the repeats,
previously
described (
39), are the following: repeat 1 (R1),
positions
84 to 98; repeat 2 (R2), positions 109 to 123; repeat 3 (R3),
positions 136 to 150; repeat 4 (R4), positions 162 to 176 (Fig.
6A). The presence of four repeat units in
the Staf minimal mRNA
activation domain represents a novel feature for
an activation
domain. Therefore, to determine whether they are
important for
the ability of Staf to stimulate transcription, internal
deletions
in full-length Staf were generated and tested again in
the
Drosophila cotransfection assay. Fig.
6B shows the
constructs that were made.
Deletions from amino acid 77 to amino acids
102 (Staf

77-102),
130 (Staf

77-130), 156 (Staf

77-156), and 220 (Staf

77-220), removed
the sequences containing R1, R1 and R2, R1 to
R3, and R1 to R4,
respectively. Truncations between amino acids 102 to
221 (Staf

103-220),
130 to 221 (Staf

131-220), and 156 to 221 (Staf

157-220) eliminated
the regions containing R2 to R4, R3 and R4,
and R4, respectively.
The expression levels and nuclear localization of
these mutant
proteins were verified by Western blot analysis (data not
shown).
The normalized values in Fig.
6C show correlation between
transcription
activity of the reporter and the number of repeat
units. Construct
Staf

77-220, with no repeat, failed to
transactivate (Fig.
6C,
lane 2). Full activity was progressively
restored, however, by
the sequential addition of sequences containing
the repeat motif
(Fig.
6C, lanes 3 to 6 and 7 to 10). The presence of
sequences
containing repeat R1 (Staf

103-220) or R4 (Staf

77-156)
resulted
in activation levels 25- and 37-fold above the basal
level, respectively
(Fig.
6C, lanes 7 and 3). When Staf proteins
containing the R1
and R2 or R3 and R4 repeat units were tested,
transcription levels
reached 40- and 45-fold of the basal level,
respectively (Fig.
6C, lanes 8 and 4, respectively). More
significantly, R1 to R3,
but especially R2 to R4, allowed the
transcription levels to attain
65- and 85-fold of the basal level (Fig.
6C, lanes 9 and 5, respectively).

View larger version (28K):
[in this window]
[in a new window]
|
FIG. 6.
Maximal transcriptional activation of an mRNA promoter
by Staf requires the presence of repeats R1 to R4. (A) Sequence of the
Staf mRNA activation domain (amino acids 84 to 176) with the location
of repeats R1 to R4. (B) Schematic representation of the seven
different effector constructs. The Staf DNA binding domain and the
repeats are indicated in the black and gray areas, respectively. (C)
Transcriptional stimulation of the AE.tkCAT promoter containing three
AE Staf binding sites, assayed in Drosophila cells. The
autoradiograph from a representative experiment is shown. The names of
the effector constructs and the relative transcriptional activities are
indicated above the lanes. The values represent the ratio of the CAT
activity to that in the absence of effector.
|
|
Taken together, these results highlight the importance of the four
repeat units of Staf to provide maximal transcription activity
to mRNA
promoters.
Comparison of the four repeats revealed the presence of seven invariant
residues located at positions 1, 5, 7, 8, 11, 12,
and 15 in each repeat
(Fig.
7A). Further, position 9 of each
repeat
is always occupied by a hydroxylated residue. A number of
alanine
substitutions were designed in the context of repeat R4
in Staf

77-156 to test whether these residues play a role in
mediating
transactivation. When Asp-168, Gly-169, and Thr-170
were substituted
(Fig.
7B, mutant D168A+G169A+T170A), the
transactivation properties
of the protein on the 3E.tkCAT promoter were
dramatically reduced
(5% of the R4 wild-type level) (Fig.
7B).
Individual alanine replacements
of Asp-168 and Thr-170 produced a
significant reduction of activity,
with the more pronounced effect
for Asp-168 (8% of residual level)
(Fig.
7B). Strikingly, the alanine
substitution of Leu-166 abolished
totally the transcriptional
activation (Fig.
7B).

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 7.
Alanine substitution mutagenesis of repeat R4 in the
Staf mRNA activation domain. (A) Sequence alignments of repeats R1 to
R4. (B) Staf 77-156 containing repeat R4 with the indicated
mutations were tested in Drosophila cells for
transcriptional activation of a cotransfected AE.tkCAT promoter
containing three AE Staf binding sites. The activity of the Staf
77-156 construct containing wild-type R4 was defined as 100. Results
are the averages (+/ values indicate standard deviations) of three
independent determinations. wt, wild type.
|
|
From this, we conclude that residues Leu-166, Asp-168, and Thr-170
contribute actively to the activity of the Staf mRNA transactivation
domain.
 |
DISCUSSION |
We have shown previously that Staf plays an important role,
not only in the transcriptional activation of snRNA and
snRNA-type genes transcribed by RNA polymerases II and III but also
to stimulate expression from an mRNA promoter (32, 38, 39).
In this study we have addressed the molecular basis of these
pleiotropic effects on transcriptional activity.
Our results summarized in Fig. 8
show that domain A, corresponding to the N-terminal region of
Staf, contains two physically and functionally distinct activation
domains acting specifically on snRNA-type and mRNA promoters. To
our knowledge, this is the first report describing such a feature
in a transactivator protein. Based on our work, we propose that the two
separate Staf activation domains are involved in two different
transactivation mechanisms: one for the specific activation of mRNA
promoters and the other for that of snRNA and snRNA-type promoters.
Forsberg et al. (11) showed that Sp1 is able to stimulate
transcription from mRNA and snRNA promoters. However, it must be
pointed out that in this case overlapping domains are involved, while
we identified two distinct, specialized domains in Staf.

View larger version (22K):
[in this window]
[in a new window]
|
FIG. 8.
Summary of Staf subdomains. (A) Schematic representation
of Staf shown with delineation of the various subdomains, based on the
present and earlier studies. (B) mRNA and snRNA activation domains.
Left panel, positions and sequence alignments of the four substructures
R1 to R4; a consensus sequence was derived at positions for which at
least three of the four repeats contain identical residues. Right
panel, sequence comparisons of the snRNA activation domain with regions
of ZNF76 and ZNF143 (35, 50). (C) Helical wheel
representation of Staf residues 212 to 220. (D) Sequence comparison of
Staf residues 212 to 220 with the -helix-1 from the Oct-1 POU
domain. The 1 helix is numbered according to Herr and Cleary
(17).
|
|
A number of activators, enhancing transcription from mRNA
promoters only, have been shown to contain multipartite activation domains. This is the situation found, for example, in TEF-1, Oct-2, and
NGF1-A (19, 36, 46). Interestingly, we have shown in this
work that Staf contains one single domain, necessary and sufficient for
optimal transactivation of an mRNA promoter containing a TATA box. This
93-amino-acid activation domain (Staf residues 84 to 176) has a net
negative charge and contains 11 and 17% of glutamine and hydroxylated
residues, respectively, in a manner analogous to what is found in many
other transactivation domains (21, 27, 51). A prominent
feature of the Staf mRNA activation domain is its 15-amino-acid motif,
repeated four times (Fig. 8B). A related situation was described for
the Oct-2 activator, which contains a twofold reiterated 18-amino-acid
motif (44). The Staf mRNA activation domain can be divided
into subregions containing one, two, three, or four substructures that
still have the potential to enhance transcription. This fact suggests
that each substructure constitutes a functional unit, even though all
four motifs are required to confer optimal transactivation potential.
In line with the occurrence of repeated substructures in Staf, previous studies revealed that artificial reiteration of an activation domain
can also lead to a significant increase in transcriptional activity
(9, 18, 40, 43, 45).
From a mechanistic point of view, involvement of a reiterated motif
in the activation process can be apprehended in two ways. In the first
one, the affinity of the activator for the basal transcription complex
is higher because the number of contacts with the target increases with
the number of repeats. Alternatively, redundance of the interaction
surfaces could raise the affinity of the activator by increasing the
probability of binding to the target. Structural studies on the VP16
and p53 activation domains suggested that the FXX
motif (X stands
for any amino acid and
for hydrophobic amino acids) is a
general recognition element of the acidic activation domain
of TAFII31 (22, 52). The Staf mRNA activation
domain, though, does not conform to this motif and presents no obvious
sequence similarity with the other known activation domains,
suggesting that it may constitute the representative of a novel
category.
Oct-1 has been shown to activate snRNA promoters with multipartite
snRNA activation domains (28, 29, 46). Instead, our study
established that Staf performs this function with one single 18-amino-acid region (residues 207 to 224) bearing no sequence similarity to other, previously identified activation domains. The mutational analysis of this domain revealed the prime importance of
the 9-amino-acid subdomain of sequence ALEQYAAKV (residues 212 to 220). This subdomain is conserved in the human proteins ZNF76
and ZNF143 (35, 50), which possess significant sequence similarities to Staf (33, 39) (Fig. 8B). This, in
addition to the finding that ZNF76 is able to activate transcription of snRNA genes (33), suggests that this new short motif plays a central role in the activation process by constituting an interaction surface within the snRNA transcription complex. Based on protein modeling algorithms, the subdomain composed of residues 212 to 220 is
predicted to form an
-helical region (7, 12). Displaying residues 212 to 220 as a putative
-helix reveals its amphipathic character, with hydrophilic residues E214, Q215, and K219 distributed on one face (Fig. 8C) and hydrophobic residues L213 and Y216, on
the other. From this observation, we propose that hydrophobic protein-protein interactions involving Leu-213 and Tyr-216 are critical
in the snRNA gene transcriptional activation by Staf.
A follow-up in the study of domain delineation in a transcriptional
activator resides in the identification of the targets that it must
contact to activate transcription. Our results show clearly that a
short domain of Staf specifically acts as a potent activator of Pol II
and Pol III snRNA and snRNA-type gene transcription. The data
additionally suggest that in the activation process the molecular
target of the snRNA activation domain is a component of the basal
Pol II and Pol III snRNA transcription complex. The multisubunit SNAPc
complex, also called the PSE transcription factor PTF, which recognizes
specifically the PSE, is the only factor known to be specific and
common to Pol II and Pol III snRNA transcription complexes (13,
31, 37, 55). In this respect, it is tempting to speculate that
Staf interacts directly or indirectly with SNAPc. The Oct-1 POU protein
has been implicated in transcriptional activation of Pol II and Pol III
snRNA promoters, as well. In this case, the POU DNA binding domain of
Oct-1 not only serves to target the protein to the octamer sequence on
the DNA but also is intimately involved in the transcriptional
activation process by stabilizing the binding of the basal
transcription complex SNAPc (10, 17, 28, 29, 31). It has
been proposed that the POU domain does so by recruiting SNAPc to the
PSE by direct protein-protein contacts involving the N-terminal part of
the POU-specific domain. It is interesting to note that the central part of the Staf snRNA activation domain bears sequence similarity to the
-helix-1 constituting the N terminus of the POU-specific domain (Fig. 8D). From this, we propose that Staf and Oct-1 recognize the same target in the SNAPc complex.
In conclusion, we have presented experimental evidence for the presence
in Staf of two functionally distinct transactivation domains with
specific snRNA-type and mRNA gene targets. This represents a
novel feature in a transactivator protein and adds an important new
dimension to structure-function studies that are being performed with
transactivation domains.
 |
ACKNOWLEDGMENTS |
We are grateful to E. Myslinski for critical reading of the
manuscript. We thank J. Hoffmann and C. Kappler for
Drosophila cell cultures, P. Remy for microinjection
facilities, A. Hoeft for oligonucleotide synthesis, and C. Loegler for
excellent technical assistance.
This work was supported by grants from the Université Louis
Pasteur in Strasbourg, the Association pour la Recherche sur le Cancer
(ARC) and the European Union (EEC Biotech Program B102-CT92-0090).
 |
FOOTNOTES |
*
Corresponding author. Mailing address: UPR 9002 du CNRS
"Structure des Macromolécules Biologiques et Mécanismes
de Reconnaissance," IBMC, 15, rue René Descartes, 67084 Strasbourg Cedex, France. Phone: (33) 3.88.41.70.50. Fax: (33)
3.88.60.22.18. E-mail: p.carbon{at}ibmc.u-strasbg.fr.
 |
REFERENCES |
| 1.
|
Ares, M., Jr.,
J.-S. Chung,
L. Giglio, and A. M. Weiner.
1987.
Distinct factors with Sp1 and NF-A specificities bind to adjacent functional elements of the human U2 snRNA gene enhancer.
Genes Dev.
1:808-817[Abstract/Free Full Text].
|
| 2.
|
Attardi, L. D., and R. Tjian.
1993.
Drosophila tissue-specific transcription factor NTF-1 contains a novel isoleucine-rich activation motif.
Genes Dev.
7:1341-1353[Abstract/Free Full Text].
|
| 3.
|
Carbon, P., and A. Krol.
1991.
Transcription of the Xenopus laevis selenocysteine tRNA(Ser)Sec gene: a system that combines an internal B box and upstream elements also found in U6 snRNA genes.
EMBO J.
10:599-606[Medline].
|
| 4.
|
Carey, M.
1991.
Mechanistic advances in eukaryotic gene activation.
Curr. Opin. Cell Biol.
3:452-460[Medline].
|
| 5.
|
Chavrier, P.,
U. Janssen-Timmen,
M. G. Mattei,
M. Zerial,
R. Bravo, and P. Charnay.
1989.
Structure, chromosome location, and expression of the mouse, zinc finger gene Krox-20: multiple gene products and coregulation with the proto-oncogene c-fos.
Mol. Cell. Biol.
9:787-797[Abstract/Free Full Text].
|
| 6.
|
Chavrier, P.,
C. Vesque,
B. Galliot,
M. Vigneron,
P. Dollé,
D. Duboule, and P. Charnay.
1990.
The segment-specific gene Krox-20 encodes a transcription factor with binding sites in the promoter region of the Hox-1.4 gene.
EMBO J.
9:1209-1218[Medline].
|
| 7.
|
Chou, P. Y., and G. D. Fasman.
1978.
Empirical predictions of protein conformation.
Annu. Rev. Biochem.
47:251-256[Medline].
|
| 8.
|
Dahlberg, J. E., and E. Lund.
1988.
The genes and transcription of the major small nuclear RNAs, p. 38-70.
In
M. L. Birnstiel (ed.), Structure and function of major and minor small nuclear ribonucleoprotein particles. Springer-Verlag, Berlin, Germany.
|
| 9.
|
Emami, K. H., and M. Carey.
1992.
A synergistic increase in potency of a multimerized VP16 transcriptional activation domain.
EMBO J.
11:5005-5012[Medline].
|
| 10.
|
Ford, E., and N. Hernandez.
1997.
Characterization of a trimeric complex containing Oct-1, SNAPc and DNA.
J. Biol. Chem.
272:16048-16055[Abstract/Free Full Text].
|
| 11.
|
Forsberg, M.,
A.-C. Ström,
P. Lillhager, and G. Westin.
1995.
Activation functions of transcription factor Sp1 U2 snRNA and TATA box promoters.
Biol. Chem. Hoppe-Seyler
376:661-669[Medline].
|
| 12.
|
Garnier, J.,
D. J. Osguthorpe, and B. Robson.
1978.
Analysis of the accuracy and implications of simple methods for predicting the secondary structure of globular proteins.
J. Mol. Biol.
120:97-120[Medline].
|
| 13.
|
Henry, R. W.,
C. L. Sadowski,
R. Kobayashi, and N. Hernandez.
1995.
A TBP-TAF complex required for transcription of human snRNA genes by RNA polymerases II and III.
Nature
374:653-657[Medline].
|
| 14.
|
Hernandez, N.
1992.
Transcription of vertebrate snRNA genes and related genes, p. 281-313.
In
S. L. MacKnight, and K. R. Yamamoto (ed.), Transcriptional regulation, vol. 1. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 15.
|
Hernandez, N.
1993.
TBP, a universal eukaryotic transcription factor?
Genes Dev.
7:1291-1308[Free Full Text].
|
| 16.
|
Herr, W.
1992.
Oct-1 and Oct-2: differential transcriptional regulation by proteins that bind to the same DNA sequence, p. 1103-1135.
In
S. L. MacKnight, and K. R. Yamamoto (ed.), Transcriptional regulation, vol. 1. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 17.
|
Herr, W., and M. A. Cleary.
1995.
The POU domain: versatility in transcriptional regulation by a flexible two-in-one DNA-binding domain.
Genes Dev.
9:1679-1693[Free Full Text].
|
| 18.
|
Hollenberg, S. M., and R. M. Evans.
1988.
Multiple and cooperative transactivation domains of the human glucocorticoid receptor.
Cell
55:899-906[Medline].
|
| 19.
|
Hwang, J.-J.,
P. Chambon, and I. Davidson.
1993.
Characterization of the transcription activation function and the DNA binding domain of the transcriptional enhancer factor-1.
EMBO J.
12:2337-2348[Medline].
|
| 20.
|
Janson, L.,
C. Bark, and U. Petterson.
1987.
Identification of proteins interacting with the human U2 small nuclear RNA genes.
Nucleic Acids Res.
15:4997-5016[Abstract/Free Full Text].
|
| 21.
|
Johnson, P. F.,
E. Sterneck, and S. C. Williams.
1993.
Activation domains of transcriptional regulatory proteins.
J. Nutr. Biochem.
4:386-398.
|
| 22.
|
Kussie, P. H.,
S. Gorina,
V. Marechal,
B. Elenbaas,
J. Moreau,
A. J. Levine, and N. P. Pavletich.
1996.
Structure of the MDM2 oncoprotein bound to the p53 tumor suppressor transactivation domain.
Science
274:948-953[Abstract/Free Full Text].
|
| 23.
|
Lescure, A.,
G. Tebb,
I. W. Mattaj,
A. Krol, and P. Carbon.
1992.
A factor with Sp1 DNA-binding specificity stimulates Xenopus U6 snRNA in vivo transcription by RNA polymerase III.
J. Mol. Biol.
228:387-394[Medline].
|
| 24.
|
Lobo, S. M., and N. Hernandez.
1989.
A 7 bp mutation converts a human RNA polymerase II snRNA promoter into an RNA polymerase III promoter.
Cell
58:55-67[Medline].
|
| 25.
|
Lobo, S. M.,
J. M. Lister,
M. L. Sullivan, and N. Hernandez.
1991.
The cloned RNA polymerase II transcription factor IID selects RNA polymerase III to transcribe the human U6 gene in vitro.
Genes Dev.
5:1477-1489[Abstract/Free Full Text].
|
| 26.
|
Mattaj, I. W.,
N. A. Dathan,
H. D. Parry,
P. Carbon, and A. Krol.
1988.
Changing the RNA polymerase specificity of U snRNA gene promoters.
Cell
55:435-442[Medline].
|
| 27.
|
Mitchell, P., and R. Tjian.
1989.
Transcriptional regulation in mammalian cells by sequence-specific DNA binding proteins.
Science
245:371-378[Abstract/Free Full Text].
|
| 28.
|
Mittal, V.,
M. A. Cleary,
W. Herr, and N. Hernandez.
1996.
The Oct-1 POU-specific domain can stimulate small nuclear RNA gene transcription by stabilizing the basal transcription complex SNAPc.
Mol. Cell. Biol.
16:1955-1965[Abstract].
|
| 29.
|
Murphy, S.
1997.
Differential in vivo activation of the class II and class III snRNA genes by the POU-specific domain of Oct-1.
Nucleic Acids Res.
25:2068-2076[Abstract/Free Full Text].
|
| 30.
|
Murphy, S.,
A. C. Di Liegro, and M. Melli.
1987.
The in vitro transcription of the 7SK RNA gene by RNA polymerase III is dependent only on the presence of an upstream promoter.
Cell
51:81-87[Medline].
|
| 31.
|
Murphy, S.,
J.-B. Yoon,
T. Gerster, and R. G. Roeder.
1992.
Oct-1 and Oct-2 potentiate functional interactions of a transcription factor with the proximal sequence element of small nuclear RNA genes.
Mol. Cell. Biol.
12:3247-3261[Abstract/Free Full Text].
|
| 32.
|
Myslinski, E.,
A. Krol, and P. Carbon.
1992.
Optimal tRNASer/Sec gene activity requires an upstream SPH motif.
Nucleic Acids Res.
20:203-209[Abstract/Free Full Text].
|
| 33.
| Myslinski, E., C. Schuster, A. Krol, and P. Carbon.
Unpublished data.
|
| 34.
|
Ptashne, M., and A. Gann.
1997.
Transcriptional activation by recruitment.
Nature
386:569-577[Medline].
|
| 35.
|
Ragoussis, J.,
P. Senger,
I. Mockridge,
P. Sanseau,
S. Ruddy,
K. Dudley,
D. Sheer, and J. Trowsdale.
1992.
A testis-expressed Zn finger gene (ZNF76) in human 6p21.3 centromeric to the MHC is closely linked to the human homolog of the t-complex gene tcp-11.
Genomics
14:673-679[Medline].
|
| 36.
|
Russo, M. W.,
C. Matheny, and J. Milbrandt.
1993.
Transcriptional activity of the zinc finger protein NGF1-A is influenced by its interaction with a cellular factor.
Mol. Cell. Biol.
13:6858-6865[Abstract/Free Full Text].
|
| 37.
|
Sadowski, C. L.,
R. W. Henry,
S. M. Lobo, and N. Hernandez.
1993.
Targeting TBP to a non-TATA box cis-regulatory element: a TBP-containing complex activates transcription from snRNA promoters through the PSE.
Genes Dev.
7:1535-1548[Abstract/Free Full Text].
|
| 38.
|
Schaub, M.,
E. Myslinski,
C. Schuster,
A. Krol, and P. Carbon.
1997.
Staf, a promiscuous activator for enhanced transcription by RNA polymerases II and III.
EMBO J.
16:173-181[Medline].
|
| 39.
|
Schuster, C.,
E. Myslinski,
A. Krol, and P. Carbon.
1995.
Staf, a novel zinc finger protein that activates the RNA polymerase III promoter of the selenocysteine tRNA gene.
EMBO J.
14:3777-3787[Medline].
|
| 40.
|
Seipel, K.,
O. Georgiev, and W. Schaffner.
1992.
Different activation domains stimulate transcription from remote (`enhancer') and proximal (`promoter') positions.
EMBO J.
11:4961-4968[Medline].
|
| 41.
|
Simmen, K. A.,
J. Bernues,
H. D. Parry,
H. G. Stunnenberg,
A. Berkenstam,
B. Cavallini,
J.-M. Egly, and I. W. Mattaj.
1991.
TFIID is required for in vitro transcription of the human U6 gene by RNA polymerase III.
EMBO J.
10:1853-1862[Medline].
|
| 42.
|
Sturm, R. A.,
G. Das, and W. Herr.
1988.
The ubiquitous octamer-binding protein Oct-1 contains a POU domain with a homeo box subdomain.
Genes Dev.
2:1582-1599[Abstract/Free Full Text].
|
| 43.
|
Sutherland, J. A.,
A. Cook,
A. J. Bannister, and T. Kouzarides.
1992.
Conserved motifs in Fos and Jun define a new class of activation domain.
Genes Dev.
6:1810-1819[Abstract/Free Full Text].
|
| 44.
|
Tanaka, M.,
W. M. Clouston, and W. Herr.
1994.
The Oct-2 glutamine-rich and proline-rich activation domains can synergize with each other or duplicates of themselves to activate transcription.
Mol. Cell. Biol.
14:6046-6055[Abstract/Free Full Text].
|
| 45.
|
Tanaka, M., and W. Herr.
1994.
Reconstitution of transcriptional activation domains by reiteration of short peptide segments reveals the modular organization of a glutamine-rich activation domain.
Mol. Cell. Biol.
14:6056-6067[Abstract/Free Full Text].
|
| 46.
|
Tanaka, M.,
J.-S. Lai, and W. Herr.
1992.
Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter.
Cell
68:755-767[Medline].
|
| 47.
|
Tebb, G., and I. W. Mattaj.
1989.
The Xenopus laevis U2 gene distal sequence element (enhancer) is composed of four subdomains that can act independently and are partly functionally redundant.
Mol. Cell. Biol.
9:1682-1690[Abstract/Free Full Text].
|
| 48.
|
Teichmann, M., and K. Seifart.
1995.
Physical separation of two different forms of human TFIIIB active in the transcription of the U6 and the VAI gene in vitro.
EMBO J.
14:5974-5983[Medline].
|
| 49.
|
Thisse, C.,
F. Perrin-Schmitt,
C. Stoetzel, and B. Thisse.
1991.
Sequence-specific transactivation of the Drosophila twist gene by the dorsal gene product.
Cell
65:1191-1201[Medline].
|
| 50.
|
Tommerup, N., and H. Vissing.
1995.
Isolation and fine mapping of 16 novel human zinc finger-encoding cDNAs identify putative candidate genes for developmental and malignant disorders.
Genomics
27:259-264[Medline].
|
| 51.
|
Triezenberg, S. J.
1995.
Structure and function of transcriptional activation domains.
Curr. Opin. Genet. Dev.
5:190-196[Medline].
|
| 52.
|
Uesugi, M.,
O. Nyanguile,
H. Lu,
A. J. Levine, and G. L. Verdine.
1997.
Induced helix in the VP16 activation domain upon binding to a human TAF.
Science
277:1310-1313[Abstract/Free Full Text].
|
| 53.
|
Vesque, C., and P. Charnay.
1992.
Mapping functional regions of the segment-specific transcription factor Krox-20.
Nucleic Acids Res.
20:2485-2492[Abstract/Free Full Text].
|
| 54.
|
Waldschmidt, R.,
I. Wanandi, and K. H. Seifart.
1991.
Identification of transcription factors required for the expression of mammalian U6 genes in vitro.
EMBO J.
8:2595-2603.
|
| 55.
|
Yoon, J.-B.,
S. Murphy,
L. Bai,
Z. Wang, and R. G. Roeder.
1995.
Proximal sequence element-binding transcription factor (PTF) is a multisubunit complex required for transcription of both RNA polymerase II- and RNA polymerase III-dependent small nuclear RNA genes.
Mol. Cell. Biol.
15:2019-2027[Abstract].
|
Mol Cell Biol, May 1998, p. 2650-2658, Vol. 18, No. 5
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Chen, X., Fang, F., Liou, Y.-C., Ng, H.-H.
(2008). Zfp143 Regulates Nanog Through Modulation of Oct4 Binding. Stem Cells
26: 2759-2767
[Abstract]
[Full Text]
-
Yuan, C.-C., Zhao, X., Florens, L., Swanson, S. K., Washburn, M. P., Hernandez, N.
(2007). CHD8 Associates with Human Staf and Contributes to Efficient U6 RNA Polymerase III Transcription. Mol. Cell. Biol.
27: 8729-8738
[Abstract]
[Full Text]
-
Myslinski, E., Gerard, M.-A., Krol, A., Carbon, P.
(2007). Transcription of the human cell cycle regulated BUB1B gene requires hStaf/ZNF143. Nucleic Acids Res
35: 3453-3464
[Abstract]
[Full Text]
-
Myslinski, E., Gerard, M.-A., Krol, A., Carbon, P.
(2006). A Genome Scale Location Analysis of Human Staf/ZNF143-binding Sites Suggests a Widespread Role for Human Staf/ZNF143 in Mammalian Promoters. J. Biol. Chem.
281: 39953-39962
[Abstract]
[Full Text]
-
Grossman, C. E., Qian, Y., Banki, K., Perl, A.
(2004). ZNF143 Mediates Basal and Tissue-specific Expression of Human Transaldolase. J. Biol. Chem.
279: 12190-12205
[Abstract]
[Full Text]
-
Di Leva, F., Ferrante, M. I., Demarchi, F., Caravelli, A., Matarazzo, M. R., Giacca, M., D'Urso, M., D'Esposito, M., Franze, A.
(2004). Human Synaptobrevin-like 1 Gene Basal Transcription Is Regulated through the Interaction of Selenocysteine tRNA Gene Transcription Activating Factor-Zinc Finger 143 Factors with Evolutionary Conserved Cis-elements. J. Biol. Chem.
279: 7734-7739
[Abstract]
[Full Text]
-
Ma, B., Hernandez, N.
(2002). Redundant Cooperative Interactions for Assembly of a Human U6 Transcription Initiation Complex. Mol. Cell. Biol.
22: 8067-8078
[Abstract]
[Full Text]
-
Schramm, L., Hernandez, N.
(2002). Recruitment of RNA polymerase III to its target promoters. Genes Dev.
16: 2593-2620
[Full Text]
-
Mach, C. M., Hargrove, B. W., Kunkel, G. R.
(2002). The Small RNA Gene Activator Protein, SphI Postoctamer Homology-binding Factor/Selenocysteine tRNA Gene Transcription Activating Factor, Stimulates Transcription of the Human Interferon Regulatory Factor-3 Gene. J. Biol. Chem.
277: 4853-4858
[Abstract]
[Full Text]
-
Schaub, M., Myslinski, E., Krol, A., Carbon, P.
(1999). Maximization of Selenocysteine tRNA and U6 Small Nuclear RNA Transcriptional Activation Achieved by Flexible Utilization of a Staf Zinc Finger. J. Biol. Chem.
274: 25042-25050
[Abstract]
[Full Text]
-
Schaub, M., Krol, A., Carbon, P.
(1999). Flexible Zinc Finger Requirement for Binding of the Transcriptional Activator Staf to U6 Small Nuclear RNA and tRNASec Promoters. J. Biol. Chem.
274: 24241-24249
[Abstract]
[Full Text]
-
Myslinski, E., Krol, A., Carbon, P.
(1998). ZNF76 and ZNF143 Are Two Human Homologs of the Transcriptional Activator Staf. J. Biol. Chem.
273: 21998-22006
[Abstract]
[Full Text]
-
Kubota, H., Yokota, S.-i., Yanagi, H., Yura, T.
(2000). Transcriptional Regulation of the Mouse Cytosolic Chaperonin Subunit Gene Ccta/t-Complex Polypeptide 1 by Selenocysteine tRNA Gene Transcription Activating Factor Family Zinc Finger Proteins. J. Biol. Chem.
275: 28641-28648
[Abstract]
[Full Text]
-
Hernandez, N.
(2001). Small Nuclear RNA Genes: a Model System to Study Fundamental Mechanisms of Transcription. J. Biol. Chem.
276: 26733-26736
[Full Text]