This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Summers, S. A.
Right arrow Articles by Birnbaum, M. J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Summers, S. A.
Right arrow Articles by Birnbaum, M. J.

 Previous Article  |  Next Article 

Molecular and Cellular Biology, September 1998, p. 5457-5464, Vol. 18, No. 9
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.

Regulation of Insulin-Stimulated Glucose Transporter GLUT4 Translocation and Akt Kinase Activity by Ceramide

Scott A. Summers,1 Luis A. Garza,1 Honglin Zhou,2 and Morris J. Birnbaum1,*

Howard Hughes Medical Institute and Departments of Medicine1 and Pharmacology,2 University of Pennsylvania, Philadelphia, Pennsylvania 19104

Received 30 April 1998/Accepted 9 June 1998

    ABSTRACT
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

The sphingomyelin derivative ceramide is a signaling molecule implicated in numerous physiological events. Recently published reports indicate that ceramide levels are elevated in insulin-responsive tissues of diabetic animals and that agents which trigger ceramide production inhibit insulin signaling. In the present series of studies, the short-chain ceramide analog C2-ceramide inhibited insulin-stimulated glucose transport by ~50% in 3T3-L1 adipocytes, with similar reductions in hormone-stimulated translocation of the insulin-responsive glucose transporter (GLUT4) and insulin-responsive aminopeptidase. C2-ceramide also inhibited phosphorylation and activation of Akt, a molecule proposed to mediate multiple insulin-stimulated metabolic events. C2-ceramide, at concentrations which antagonized activation of both glucose uptake and Akt, had no effect on the tyrosine phosphorylation of insulin receptor substrate 1 (IRS-1) or the amounts of p85 protein and phosphatidylinositol kinase activity that immunoprecipitated with anti-IRS-1 or antiphosphotyrosine antibodies. Moreover, C2-ceramide also inhibited stimulation of Akt by platelet-derived growth factor, an event that is IRS-1 independent. C2-ceramide did not inhibit insulin-stimulated phosphorylation of mitogen-activated protein kinase or pp70 S6-kinase, and it actually stimulated phosphorylation of the latter in the absence of insulin. Various pharmacological agents, including the immunosuppressant rapamycin, the protein synthesis inhibitor cycloheximide, and several protein kinase C inhibitors, were without effect on ceramide's inhibition of Akt. These studies demonstrate ceramide's capacity to inhibit activation of Akt and imply that this is a mechanism of antagonism of insulin-dependent physiological events, such as the peripheral activation of glucose transport and the suppression of apoptosis.

    INTRODUCTION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

Insulin stimulates glucose uptake into muscle and adipose tissues by effecting the redistribution of the insulin-responsive glucose transporter GLUT4 from intracellular stores to the plasma membrane. Subsequently, insulin activates numerous metabolic pathways which promote the storage of the incoming glucose as glycogen or fat. Insulin transmits its signals through a cell surface tyrosine kinase receptor which stimulates multiple intracellular signaling events (reviewed in reference 41). Activated insulin receptors phosphorylate adapter proteins, such as members of the insulin receptor substrate (IRS) family, which recruit and activate downstream effector molecules. One of these proteins, phosphatidylinositol 3-kinase (PI 3-kinase), is requisite for insulin's acute regulation of glucose metabolism. Treatment with either of the PI 3-kinase inhibitors wortmannin or LY294002 blocks insulin's effects on glucose metabolism (6, 7, 35, 49), while expression of constitutively active forms of PI 3-kinase stimulates them (14, 26, 33). In single-cell assays, microinjection of dominant negative forms of PI 3-kinase (19, 31) or inhibitory PI 3-kinase antibodies (20) blocks GLUT4 translocation.

Recent studies suggest a role for the serine/threonine kinase Akt/protein kinase B (PKB) as a mediator of PI 3-kinase's metabolic effects. Akt/PKB was isolated independently by three laboratories in 1991. Two groups isolated the protein as a result of its homology with PKC and PKA; hence, one group named it PKB (8), and the other named it RAC-PK (related to A and C protein kinase) (23). Simultaneously, a third laboratory identified the protein as the transforming component of the AKT8 retrovirus found in a rodent T-cell lymphoma and named it Akt (3). Akt/PKB is activated by insulin and other growth factors in a variety of cell types, often in a manner dependent on PI 3-kinase (13). Expression of constitutively active forms of Akt in appropriate tissues stimulates glucose uptake, GLUT4 translocation, glycogen synthase, lipogenesis, and protein synthesis (9, 28, 41, 45, 47). Akt's stimulation of glucose uptake and GLUT4 translocation is insensitive to inhibition by wortmannin (42), suggesting that Akt activates insulin signaling pathways downstream of PI 3-kinase. Furthermore, inducible expression of a constitutively active Akt is temporally associated with increases in glucose uptake, GLUT4 translocation, and glycogen synthesis (27).

Intramuscular ceramide concentrations are elevated in skeletal muscle obtained from insulin-resistant rats (46), and ceramide analogs inhibit insulin-stimulated glucose uptake in cultured adipocytes (48). Other studies report that ceramide antagonizes the earliest events in insulin signaling (25, 37), although these results are controversial (48). The experiments described herein tested the hypothesis that ceramide prevents activation of Akt. Specifically, studies of the effect of ceramide on insulin-dependent signaling and metabolic events in 3T3-L1 adipocytes were performed. Data presented below indicate that a short-chain ceramide analog, C2-ceramide, inhibits glucose uptake, GLUT4 translocation, and Akt phosphorylation and activation in 3T3-L1 adipocytes independently of any effect on IRS-1.

    MATERIALS AND METHODS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

Antibodies and reagents. Polyclonal sheep anti-GLUT4 antibodies were raised against a glutathione S-transferase (GST) fusion protein containing the last 31 amino acids of the GLUT4 carboxyl terminus (GST-ISATFRRTPSLLEQEVKPSTELEYLGPDEND). Polyclonal rabbit antibodies were raised against the sequence CDQTHFPQFSYSASIRE found in Akt2 (anti-Akt2 antibodies). Polyclonal rabbit anti-phospho-S6 antibodies were raised against the major phosphorylation site in the ribosomal S6 subunit [CRRLS(P)S(P)LRAS(P)TSKS(P)EES(P)QK, where P is the phosphoryl associated with the amino acid which precedes it], Anti-p85 antibodies were raised by Rockland, Inc. (Gilbertsville, Pa.), against a protein in which GST is fused to the N-terminal SH2 domain of p85, kindly provided by Jonathan Backer (Albert Einstein College of Medicine). Anti-phospho-mitogen activated protein kinase (MAPK) antibodies were from Promega (Madison, Wis.), anti-phospho-Akt and anti-phospho-p70 antibodies were from New England Biolabs (Beverly, Mass.), and agarose-bound antiphosphotyrosine antibodies were from Upstate Biotechnology, Inc. (Lake Placid, N.Y.). Anti-insulin-responsive aminopeptidase (IRAP), anti-IRS-1, and anti-pp70 antibodies were generously donated by Metabolex (Hayward, Calif.), Miles Pharmaceuticals (West Haven, Conn.), and Margaret Chou (University of Pennsylvania), respectively.

C2-ceramide, C2-dihydroceramide, rapamycin, and the protein kinase inhibitors staurosporine, bisindolymaleimide, Gö 6976, Gö 6983, H-89 dihydrochloride, ML-7, and KN-93 were from Calbiochem (La Jolla, Calif.). Okadaic acid was from Gibco/BRL (Gaithersburg, Md.). Porcine insulin was a gift from Eli Lilly (Indianapolis, Ind.).

Akt constructs, retroviral infection, and cell culture. 3T3-L1 fibroblasts were differentiated into adipocytes 2 days postconfluence in Dulbecco's modified Eagle's-H21 medium supplemented with 10% fetal bovine serum, 1 µg of dexamethasone per ml, and 112 µg of isobutylmethylxanthine per ml. After 3 days, cells were maintained in Dulbecco's modified Eagle's-H21 medium supplemented with 10% fetal bovine serum. 3T3-L1 fibroblasts expressing a constitutively active form of Akt [myr-akt (Delta 4-129)] and empty vector were generously provided by Richard Roth, Stanford University, Stanford, Calif. (29).

Glucose uptake and GLUT4 translocation assays. Methods for measuring glucose uptake rates and plasma membrane GLUT4 levels (with the plasma membrane sheet assay) have been described (29).

IRAP translocation assay. IRAP translocation was determined with an IRAP biotinylation assay similar to that described previously (38). 3T3-L1 adipocytes in 60-mm-diameter dishes were washed in phosphate-buffered saline and left in Leibovitz-15 medium (Sigma Chemical Co.) with 0.2% bovine serum albumin for 2 h at 37°C. The medium contained either ceramide, dihydroceramide, or carrier ethanol as described in the figure legends. Cells were stimulated with 20 nM insulin for 10 min in the same medium and moved to ice. All subsequent steps were performed at 4°C. Cells were washed twice in ice-cold KRPH (128 mM NaCl, 4.7 mM KCl, 1.25 mM CaCl2, 1.25 mM MgSO4, 5 mM NaPO4, 20 mM HEPES [pH 7.4]) and treated with 3 ml of 0.5-mg/ml sulfo-NHS-LC-LC-biotin (Pierce) for 30 min. Each plate was then bathed three times for 5 min each time in KRPH plus 20 mM glycine, bathed once in KRPH, and finally lysed in 500 µl of solubilization buffer (1% Triton, 150 mM NaCl, 20 mM Tris-Cl, 5 mM EDTA, 1 mM phenylmethanesulfonyl fluoride, 10 µg of aprotinin per ml, 10 µM leupeptin, 1 µM pepstatin A [pH 7.4]). The lysate was vortexed briefly, incubated for 10 min, and centrifuged at 23,000 × g for 20 min. The fat cake was removed, and 50 µl of the remaining lysate was diluted to 500 µl with solubilization buffer and immunoprecipitated with 3 µl of anti-IRAP serum (Metabolex) for 1 h, followed by overnight incubation in 30 µl of protein A-Sepharose (Gibco). Samples were eluted in sodium dodecyl sulfate (SDS), and the eluate was divided into two parts; 80% was allocated for a gel to quantitate the amount of biotin, and 20% was allocated for a gel to quantitate the amount of IRAP immunoprecipitated.

SDS gels intended for biotin quantitation were transferred to polyvinylidene difluoride membranes (Fisher), blocked in Tris-buffered saline containing 0.2% Tween with 6% bovine serum albumin, treated with 1 µg of streptavidin-horseradish peroxidase (HRP) (Pierce) per ml for 2 h, washed in Tris-buffered saline containing 0.2% Tween, and developed with an enhanced chemifluorescence kit (Amersham) on a STORM 860 scanner. SDS gels used for IRAP quantitation were treated identically to those for biotin quantitation except for the use of nonfat dry milk and application of anti-IRAP serum (1:2,000) and goat anti-rabbit HRP-conjugated antibody (1:5,000).

Protein immunoblotting, immunoprecipitation, and measurement of activity. Western blots of total cell lysates were prepared and analyzed as described previously (43). Akt kinase assays were conducted as previously described (43), except that some of them were conducted with the phospho-Akt1-specific antibody from New England Biolabs instead of the anti-Akt2 antibody described above. Phospho-Akt1-specific antibodies were used at the concentrations indicated by the manufacturer. IRS-1 was immunoprecipitated by solubilizing cells as described for Akt kinase assays and incubating them with 5 µl of anti-IRS-1 antibodies. Following 1 to 3 h of incubation at 4°C, 20 µl of washed protein A-agarose (Gibco/BRL) was added and the incubation was extended for another 20 to 30 min. The protein A-agarose was then washed three times in ice-cold lysis buffer without protease inhibitors and solubilized in Laemmli solubilization buffer. PI 3-kinase assays were then performed by methods previously described (44).

    RESULTS
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

The effects of ceramide on insulin-mediated events were investigated by using the short-chain ceramide analog C2-ceramide. Although hydrophobic enough to cross the membrane bilayer, C2-ceramide disperses more easily in the incubation medium and is metabolized more slowly than ceramide, and it is thus a reagent commonly used for investigating ceramide's effects. The closely related C2-dihydroceramide lacks biological activity (17) and is used as a negative control. Consistent with a previous study (48), C2-ceramide inhibited insulin-stimulated glucose uptake into 3T3-L1 adipocytes without affecting basal transport rates (Fig. 1).


View larger version (19K):
[in this window]
[in a new window]
 
FIG. 1.   C2-ceramide inhibits insulin-stimulated glucose uptake. 3T3-L1 adipocytes were incubated with C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) for 2 h, with insulin present for the last 15 min. The uptake of radiolabeled 2-deoxyglucose was measured for 4 min. The asterisk denotes that the difference from the uptake in the presence of insulin alone was statistically significant at a P value of <0.05. Data presented are the averages ± standard errors of the means of three independent measurements.

As described above, insulin accelerates glucose uptake by stimulating the translocation of GLUT4 from a poorly defined intracellular compartment to the plasma membrane. In addition, IRAP apparently resides in this compartment and translocates to the plasma membrane, like GLUT4 (24, 34). The effect of C2-ceramide on the insulin-dependent translocation of these proteins was determined by two independent methods. The GLUT4 sheet assay was used to measure plasma membrane GLUT4 levels (29). Briefly, 3T3-L1 adipocytes differentiated on coverslips were sonicated, liberating cellular structures from each coverslip but leaving an intact sheet containing the plasma membrane with its cytosolic face exposed. Probing the sheet with antibodies raised against the carboxyl terminus of GLUT4 reveals the total amount of GLUT4 on the membrane. Insulin caused a 10-fold increase in plasma membrane GLUT4 levels, which were reduced by ~50% following a 2-h incubation with ceramide (Fig. 2A and B). This matched the inhibition in insulin-stimulated glucose transport observed under identical conditions. C2-ceramide similarly inhibited the translocation of IRAP. IRAP contains numerous lysine residues on its exofacial surface, allowing easy biotinylation of the protein (38). Cell surface biotinylation followed by specific immunoprecipitation of IRAP reveals the amount of cell surface IRAP. Insulin caused a 10-fold stimulation of IRAP biotinylation due to the translocation of IRAP to the plasma membrane. C2-ceramide inhibited IRAP translocation by 40 to 60%, again consistent with the inhibition of glucose transport and GLUT4 translocation. Basal plasma membrane GLUT4 and IRAP levels were not reduced by C2-ceramide. These data indicate that ceramide antagonizes insulin's stimulation of glucose transport and its redistribution of these two proteins.


View larger version (35K):
[in this window]
[in a new window]
 
FIG. 2.   C2-ceramide inhibits insulin-stimulated GLUT4 and IRAP translocation. Plasma membrane GLUT4 (A and B) and IRAP (C and D) levels were measured as described in Materials and Methods. In both assays, C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) was added 2 h prior to initiation of the assay. Insulin (20 nM) was present for the last 10 min. Immunofluorescence detection of GLUT4 on plasma membrane sheets was performed with polyclonal sheep anti-GLUT4 primary antibodies followed by rhodamine-conjugated anti-sheep secondary antibodies. Images were captured with a digital camera (A) and quantitated as described in Materials and Methods (B). Biotinylated IRAP was detected with streptavidin-HRP and visualized with enhanced chemifluorescence (C), and the results were quantitated on a phosphorimager (D). Each asterisk denotes that the difference from the value obtained in the presence of insulin alone was statistically significant at a P value of <0.05. Data presented are the averages ± standard errors of the means of three independent measurements.

Since glucose uptake (29, 45) and GLUT4 (29, 45) and IRAP (16) translocation are known to be stimulated by constitutively active forms of Akt (29), the effect of C2-ceramide on Akt phosphorylation and activity was investigated. Commercially available antibodies raised against a regulatory phosphorylation site on Akt allow for a direct assessment of that protein's phosphorylation state. Moreover, antibodies raised against the carboxyl terminus of Akt reveal a dramatic insulin-induced mobility shift when the protein is separated on low-percentage-polyacrylamide gels. Both types of antibodies precipitate insulin-dependent kinase activity as revealed by measuring 32P incorporation into histone. C2-ceramide markedly inhibited the phosphorylation, mobility shift, and precipitation of kinase activity by both types of antibodies (Fig. 3). C2-ceramide's inhibition of Akt kinase activity was more pronounced when the anti-phospho-Akt antibody, which presumably recognizes only activated Akt and therefore precipitates less basal kinase activity, was used than when the anti-Akt2 antibody was used. In both cases, the degree of inhibition was consistent with that observed in glucose transport and GLUT4 and IRAP translocation assays.


View larger version (29K):
[in this window]
[in a new window]
 
FIG. 3.   C2-ceramide inhibits Akt. 3T3-L1 adipocytes were treated with C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) for 2 h prior to solubilization. Insulin (20 nM) was present for the last 10 min. Western blots of total cell lysates were probed with anti-phospho-Akt1 antibodies (A) or anti-Akt2 antibodies (D). Kinase activities in immunocomplexes obtained with anti-phospho-Akt1 antibodies (B and C) or anti-Akt2 antibodies (E and F) were determined by measuring the incorporation of 32P into histone, which was either visualized by autoradiography (B and E) or quantitated on a phosphorimager (C and F). Each asterisk denotes that the difference from the activity in the presence of insulin alone was statistically significant at a P value of <0.05. Data are the averages ± standard errors of the means of three independent measurements.

C2-ceramide's effects on Akt were apparent within 1 h of treatment (Fig. 4). In contrast, C2-ceramide did not inhibit insulin-stimulated phosphorylation of MAPK, pp70 S6-kinase, or the ribosomal S6 subunit (Fig. 4). Moreover, C2-ceramide did not alter the insulin-induced mobility shift observed for IRS-1 (Fig. 4) or pp70 (data not shown). These results indicate that C2-ceramide specifically inhibits insulin's stimulation of Akt1 and Akt2 without affecting other insulin-mediated pathways.


View larger version (60K):
[in this window]
[in a new window]
 
FIG. 4.   Time course of ceramide's effects on Akt. Total cell lysates were prepared from 3T3-L1 adipocytes preincubated with C2-ceramide (100 µM) for the indicated periods of time, with insulin (20 nM) present for the last 10 min. Western blots were then probed with the indicated antibodies (Ab) and examined by enhanced chemiluminescence. Data are representative of five independent experiments. alpha PAkt, anti-phospho-Akt; alpha PMAPK, anti-phospho-MAPK; alpha P56, anti-phospho-S6; alpha Pp70, anti-pp70; -, no ceramide present.

To investigate the effects of C2-ceramide on Akt-stimulated glucose transport, 3T3-L1 adipocytes stably expressing a constitutively active form of Akt (myr-akt) (described in reference 29) were evaluated. myr-akt expression caused a 10-fold glucose uptake stimulation which was insensitive to C2-ceramide (Fig. 5). These data indicate that the membrane targeting of Akt is sufficient to bypass the inhibitory actions of ceramide.


View larger version (19K):
[in this window]
[in a new window]
 
FIG. 5.   C2-ceramide does not inhibit myr-akt-stimulated glucose transport. 3T3-L1 adipocytes expressing empty vector or myr-akt were incubated with C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) for 2 h, with insulin present for the last 15 min. The uptake of radiolabeled 2-deoxyglucose was measured for 4 min. Data presented are the averages ± standard errors of the means of three independent measurements.

C2-ceramide concentrations which inhibited glucose transport and Akt activity did not affect very early insulin signaling events, including the IRS-1-mediated activation of PI 3-kinase. First, ceramide did not affect the tyrosine phosphorylation of IRS-1 as determined by immunoblotting of anti-IRS-1 precipitates with anti-phosphotyrosine antibodies (Fig. 6). Second, C2-ceramide did not inhibit the tyrosine phosphorylation of the insulin receptor examined by methods similar to those used to study the phosphorylation of IRS-1 (data not shown). Third, C2-ceramide did not affect the amount of p85 protein which immunoprecipitated with anti-IRS-1 or anti-phosphotyrosine antibodies (Fig. 7A). And fourth, C2-ceramide did not affect the amount of PI 3-kinase activity in anti-IRS-1 precipitates (Fig. 7B). To investigate whether ceramide also inhibited Akt phosphorylation or activation by agents which do not depend on IRS-1 for signaling, the effect of ceramide on platelet-derived growth factor (PDGF)-stimulated Akt phosphorylation was investigated. Since PDGF is a weak stimulator of Akt phosphorylation in 3T3-L1 adipocytes (45) but is a potent activator in fibroblasts (5), undifferentiated fibroblasts were used. Insulin stimulation and PDGF stimulation of Akt phosphorylation were equally sensitive to ceramide (Fig. 8). Taken together, these results indicate that altered phosphorylation of IRS-1 or activation of PI 3-kinase does not mediate ceramide's inhibition of Akt activation.


View larger version (29K):
[in this window]
[in a new window]
 
FIG. 6.   C2-ceramide does not inhibit tyrosine phosphorylation of IRS-1. 3T3-L1 adipocytes were treated with C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) for 2 h prior to solubilization, with insulin (20 nM) present for the last 10 min. IRS-1 was immunoprecipitated (IP), separated on SDS-polyacrylamide gel electrophoresis gels, and transferred to nitrocellulose. Western blots (WB), were probed with antiphosphotyrosine antibodies (alpha pTyr), and the blots shown are representative of two independent experiments.


View larger version (33K):
[in this window]
[in a new window]
 
FIG. 7.   C2-ceramide does not inhibit recruitment or activation of PI 3-kinase. 3T3-L1 adipocytes were treated with C2-ceramide (C2) (100 µM) or C2-dihydroceramide (C2H2) (100 µM) for 2 h prior to solubilization. Insulin (Ins) (20 nM) was present for the last 10 min. (A) Proteins were immunoprecipitated (IP) with antibodies to IRS-1 (alpha IRS1) or phosphotyrosine (alpha pTyr), separated on SDS-polyacrylamide gel electrophoresis gels, and transferred to nitrocellulose. Western blots (WB) were probed with anti-p85 antibodies and the blots shown are representative of two independent experiments. IgG, immunoglobulin G. (B) PI 3-kinase activity in anti-IRS-1 immunoprecipitates was measured as described in the text, and the radioactivity incorporated into phosphatidylinositol 3-phosphate was visualized by autoradiography (upper panel) or quantitated on a phosphorimager (lower panel).


View larger version (36K):
[in this window]
[in a new window]
 
FIG. 8.   C2-ceramide inhibits insulin- and PDGF-stimulated Akt phosphorylation in fibroblasts. Total cell lysates were prepared from 3T3-L1 fibroblasts preincubated with C2-ceramide (C2) (100 µM) for 2 h followed by a 10-min incubation with insulin (1 µM) or PDGF (50 ng/ml). Proteins were separated by SDS-polyacrylamide gel electrophoresis and transferred to nitrocellulose, and Western blots were then probed with anti-phospho-Akt antibodies (alpha PAkt).

In further studies we attempted to identify the ceramide target responsible for its inhibition of Akt phosphorylation. The addition of C2-ceramide in the absence of insulin stimulated the phosphorylation of the S6 ribosomal subunit, a marker of pp70 S6-kinase activity (Fig. 9A). To investigate whether activation of pp70 by C2-ceramide was responsible for the inhibited Akt, the immunosuppressant rapamycin was utilized. Under the conditions described, rapamycin completely inhibited S6 phosphorylation (data not shown) without affecting ceramide's inhibition of Akt phosphorylation (Fig. 9B). Similarly, the protein synthesis inhibitor cycloheximide did not affect Akt phosphorylation.


View larger version (30K):
[in this window]
[in a new window]
 
FIG. 9.   C2-ceramide does not require protein synthesis to inhibit Akt. Total cell lysates were prepared from 3T3-L1 adipocytes incubated with C2-ceramide (C2) or C2 dihydroceramide (C2H2) (100 µM) for 2 h, with insulin (Ins) (20 nM) present of these lysates for the last 10 min. Western blots in the indicated samples were then probed with the indicated antibodies and examined by enhanced chemiluminescence. Data are representative of two independent experiments. For the blots shown in panel B, cells were treated as described for panel A, except that indicated samples additionally received rapamycin (Rap) (20 ng/ml) or cycloheximide (Cyclohex) (100 µM). alpha P-MAPK, anti-phospho-MAPK; alpha P-S6, anti-phospho-S6; alpha P-Akt, anti-phospho-Akt; -, no ceramide present.

Akt is inactivated through dephosphorylation by protein phosphatase 2A (PP2A) (2), and a reported intracellular target of ceramide is the okadaic acid-sensitive PP2A-like phosphatase ceramide-activated protein phosphatase (11, 32). Treatment of cells with okadaic acid, which blocks PP2A activity, did not affect ceramide's inhibition of Akt (Fig. 10A). Another target of ceramide is PKC isoform zeta  (15), which also physically associates with Akt (30). However, Gö 6983 (40), an inhibitor of PKC isoforms alpha , beta , delta , gamma , and zeta  did not affect ceramide's inhibition of Akt phosphorylation (Fig. 10B). Similarly, a variety of other protein kinase inhibitors, including the general protein kinase inhibitor staurosporine, the PKC inhibitors bisindolymaleimide and Gö 6976 (40), the PKA inhibitor H-89 dihydrochloride, the myosin light-chain kinase (MLCK) inhibitor ML-7, and the Ca2+/calmodulin kinase II inhibitor KN-93, did not prevent ceramide's inhibition of Akt phosphorylation (Fig. 10C).


View larger version (38K):
[in this window]
[in a new window]
 
FIG. 10.   Protein kinase inhibitors do not affect C2-ceramide's inhibition of Akt. Total cell lysates were prepared from 3T3-L1 adipocytes incubated with C2-ceramide (C2) (100 µM) for 2 h. Insulin (20 nM) was present for the last 10 min. All of the protein kinase inhibitors were added to the incubation medium 2 h prior to addition of insulin. The final concentrations were 200 µM for the PKG inhibitor and 1 µM for all others. Western blots of these lysates were probed with anti-phospho-Akt and examined by enhanced chemiluminescence. Data are representative of two independent experiments. Inhib., inhibitor; KN, KN-93; alpha PAkt, anti-phospho-Akt antibodies.

    DISCUSSION
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

These studies investigated the effects of ceramide on insulin signaling pathways as well as physiologically important metabolic responses. The experiments clearly demonstrate that C2-ceramide antagonizes insulin-stimulated glucose uptake and GLUT4 and IRAP translocation in 3T3-L1 adipocytes. The specific event modified apparently occurs between activation of PI 3-kinase and subsequent stimulation of Akt: (i) C2-ceramide inhibited insulin- and PDGF-stimulated Akt phosphorylation on a key regulatory residue (Fig. 3, 4, and 8), (ii) it reduced Akt kinase activities precipitated by two different antibodies (Fig. 3), (iii) it inhibited an insulin-induced mobility shift in Akt separated on polyacrylamide gels (Fig. 3 and 4), and (iv) its inhibitory actions on glucose transport were bypassed by overexpression of a constitutively active form of Akt. In contrast, C2-ceramide did not inhibit insulin's activation of PI 3-kinase (Fig. 7) and other insulin-dependent signaling events (Fig. 4 and 6). This novel, antagonistic relationship between ceramide levels and the activation of Akt could have widespread implications, particularly given the numerous stimuli which modulate these signaling molecules.

The mechanism by which ceramide inhibits Akt phosphorylation is unclear. Akt is phosphorylated predominantly at two regulatory sites (T308 and S473), both of which are required for complete activation (1). Phosphorylation at both sites is dependent upon PI 3-kinase activity (1), and kinases capable of phosphorylating the T308 residue have been identified (12). However, the kinase(s) responsible for S473 phosphorylation, a process inhibited by ceramide, has not been discovered. Whether ceramide (or one of its metabolites) acts directly on these kinases or acts through some other intermediate(s) is clearly of interest. Experiments investigating other known downstream effectors of ceramide failed to reveal a likely mediator of ceramide's actions on Akt phosphorylation. Inhibitors of ceramide-activated protein phosphatase (11, 32), PKCzeta (15), and pp70 S6-kinase did not block ceramide's effects on Akt (Fig. 9 and 10). Moreover, protein synthesis inhibitors failed to affect ceramide's antagonistic actions (Fig. 9), indicating that transcriptional or translational events are not required.

The results of the ceramide experiments presented above contradict some, but not all, reports regarding ceramide's effects on early insulin signaling events. In agreement with the studies described above, Wang et al. reported that ceramide inhibited neither tyrosine phosphorylation of IRS-1 nor its recruitment of the regulatory p85 subunit of PI 3-kinase in 3T3-L1 adipocytes (48). In contrast, two other groups reported that ceramide inhibited insulin's tyrosine phosphorylation of IRS-1 in multiple other cell lines (25, 37). These two groups did not investigate recruitment of p85, and none of the groups measured PI 3-kinase activity directly. The data described herein also failed to demonstrate an effect of ceramide on tyrosine phosphorylation of IRS-1 or its recruitment and activation of PI 3-kinase. However, regardless of the conditions under which ceramide is capable of inhibiting tyrosine phosphorylation of IRS-1, its blockade of Akt activation must also occur through an alternative mechanism. Perhaps the most convincing argument for this is that ceramide inhibits Akt phosphorylation in response to both insulin and PDGF (Fig. 8), despite the fact that the latter does not utilize IRS-1 as a signaling intermediate. Intriguingly, many events in which Akt is implicated, such as antiapoptosis, anabolic metabolism, and adipogenesis, are inhibited by agents which produce ceramide or the lipid itself (18, 21, 22, 36).

The finding that C2-ceramide suppresses GLUT4 translocation also contrasts with a prior study (48) in which ceramide inhibited insulin-stimulated glucose uptake into 3T3-L1 adipocytes but failed to affect the GLUT4 content of plasma membrane fractions from insulin-stimulated cells. The GLUT4 translocation data presented in the previous study are difficult to reconcile with both the transport data acquired in that study and the translocation data presented above. The studies described herein utilized the GLUT4 sheet and IRAP biotinylation assays (Fig. 2), which are more sensitive methods for detecting translocation than subcellular fractionation. The possibility of fraction impurity in the aforementioned studies is a plausible explanation for the inconsistencies between the two results.

Implications for insulin resistance. Insulin resistance is an important contributor to the pathogenesis of type II diabetes mellitus. Since the majority of type II diabetics are obese, a search is under way for signaling molecules secreted from fat which could cause insulin resistance in the major site for glucose disposal, skeletal muscle. Tumor necrosis factor alpha (TNF) and free fatty acids (FFA) have been proposed as links between adiposity and the development of insulin resistance (4, 21), and ceramide has been invoked as a principal mediator of both agents (10, 39). TNF produces ceramide through the FAN-mediated activation of sphingomyelinase, while fatty acids contribute to de novo synthesis (reviewed in references 17 and 36). The studies described herein suggest a mechanism for either TNF- or FFA-induced ceramide production in the development of insulin resistance through indirect inhibition of Akt/PKB. Interestingly, a recent report (39) has shown that FFA-dependent increases in pancreatic beta -cell ceramide levels account for the reduced insulin-secretory capacity in a rodent model of type II diabetes. The present report raises the intriguing idea that concerted effects of ceramide on muscle and the pancreas account for both the peripheral and insulin-secretory defects associated with type II diabetes mellitus.

    ACKNOWLEDGMENTS

This work was supported by NIH grants DK39615 (to M.J.B.) and DK09375 (to S.A.S.) and a grant from the Cox Institute (to M.J.B.).

We express gratitude to several individuals and organizations for their generous contributions to this paper. Margaret Chou (University of Pennsylvania), Jonathan Backer (Albert Einstein College of Medicine), and Metabolex kindly donated anti-pp70 antibodies, p85-GST fusion proteins, and anti-IRAP antibodies, respectively. Aimee Kohn and Richard Roth (Stanford University) generated the 3T3-L1 adipocytes stably expressing constitutively active forms of Akt. Randy Pittman (University of Pennsylvania) shared valuable information from his own laboratory. Eileen Whiteman (University of Pennsylvania) provided useful technical assistance regarding Akt kinase assays, and Robyn Tuttle (University of Pennsylvania) donated a number of reagents, solutions, and cells. Finally, Cass Lutz (University of Pennsylvania) provided assistance in the typing and editing of the manuscript.

    FOOTNOTES

* Corresponding author. Mailing address: Howard Hughes Medical Institute and Department of Medicine, University of Pennsylvania, Clinical Research Building, 415 Curie Blvd., Philadelphia, PA 19104. Phone: (215) 898-5001. Fax: (215) 573-9138. E-mail: birnbaum{at}hhmi.upenn.edu.

    REFERENCES
Top
Abstract
Introduction
Materials & Methods
Results
Discussion
References

1. Alessi, D. R., M. Andjelkovic, B. Caudwell, P. Cron, N. Morrice, P. Cohen, and B. A. Hemmings. 1996. Mechanism of activation of protein kinase B by insulin and IGF-1. EMBO J. 15:6541-6551[Medline].
2. Andjelkovic, M., T. Jakubowicz, P. Cron, X. F. Ming, J. W. Han, and B. A. Hemmings. 1996. Activation and phosphorylation of a pleckstrin homology domain containing protein kinase (RAC-PK/PKB) promoted by serum and protein phosphatase inhibitors. Proc. Natl. Acad. Sci. USA 93:5699-5704[Abstract/Free Full Text].
3. Bellacosa, A., J. R. Testa, S. P. Staal, and P. N. Tsichlis. 1991. A retroviral oncogene, akt, encoding a serine-threonine kinase containing an SH2-like region. Science 254:274-277[Abstract/Free Full Text].
4. Boden, G. 1997. Role of fatty acids in the pathogenesis of insulin resistance and NIDDM. Diabetes 46:3-10[Abstract].
5. Burgering, M., and P. Coffer. 1995. Protein kinase B (c-Akt) in phosphatidylinositol-3-OH kinase signal transduction. Nature 376:599-602[Medline].
6. Cheatham, B., C. J. Vlahos, L. Cheatham, L. Wang, J. Blenis, and C. R. Kahn. 1994. Phosphatidylinositol 3-kinase activation is required for insulin stimulation of pp70 S6 kinase, DNA synthesis, and glucose transporter translocation. Mol. Cell. Biol. 14:4902-4911[Abstract/Free Full Text].
7. Clarke, J. F., P. W. Young, K. Yonezawa, M. Kasuga, and G. D. Holman. 1994. Inhibition of the translocation of GLUT1 and GLUT4 in 3T3-L1 cells by the phosphatidylinositol 3-kinase inhibitor, wortmannin. Biochem. J. 300:631-635.
8. Coffer, P. J., and J. R. Woodgett. 1991. Molecular cloning and characterization of a novel putative protein-serine kinase related to the cAMP-dependent and protein kinase C families. Eur. J. Biochem. 201:475-481[Medline]. (Erratum, 205:1217, 1992.)
9. Cong, L.-N., H. Chen, Y. Li, L. Zhou, M. McGibbon, S. Taylor, and M. Quon. 1997. Physiological role of Akt in insulin-stimulated translocation of GLUT4 in transfected rat adipose cells. Mol. Endocrinol. 11:1881-1890[Abstract/Free Full Text].
10. Darnay, B. G., and B. B. Aggarwal. 1997. Early events in TNF signaling: a story of associations and dissociations. J. Leukoc. Biol. 61:559-566[Abstract].
11. Dobrowsky, R. T., and Y. A. Hannun. 1992. Ceramide stimulates a cytosolic protein phosphatase. J. Biol. Chem. 267:5048-5051[Abstract/Free Full Text].
12. Downward, J. 1998. Lipid-regulated kinases: some common themes at last. Science 279:673-674[Free Full Text].
13. Franke, T. F., D. R. Kaplan, and L. C. Cantley. 1997. PI3K: downstream AKTion blocks apoptosis. Cell 88:435-437[Medline].
14. Frevert, E. U., and B. B. Kahn. 1997. Differential effects of constitutively active phosphatidylinositol 3-kinase on glucose transport, glycogen synthase activity, and DNA synthesis in 3T3-L1 adipocytes. Mol. Cell. Biol. 17:190-198[Abstract].
15. Galve-Roperh, I., A. Haro, and I. Diaz-Laviada. 1997. Ceramide-induced translocation of protein kinase C zeta in primary cultures of astrocytes. FEBS Lett. 415:271-274[Medline].
16. Garza, L. A., and M. J. Birnbaum. Unpublished data.
17. Hannun, Y. 1994. The sphingomyelin cycle and the second messenger function of ceramide. J. Biol. Chem. 269:3125-3128[Free Full Text].
18. Hannun, Y. A., and L. M. Obeid. 1995. Ceramide: an intracellular signal for apoptosis. Trends Biochem. Sci. 20:73-77[Medline].
19. Haruta, T., A. J. Morris, D. W. Rose, J. G. Nelson, M. Mueckler, and J. M. Olefsky. 1995. Insulin-stimulated GLUT4 translocation is mediated by a divergent intracellular signaling pathway. J. Biol. Chem. 270:27991-27994[Abstract/Free Full Text].
20. Hausdorff, S. E., and M. J. Birnbaum. Unpublished data.
21. Hotamisligil, G. S., and B. M. Spiegelman. 1994. Tumor necrosis factor alpha: a key component of the obesity-diabetes link. Diabetes 43:1271-1278[Abstract].
22. Jarvis, W. D., S. Grant, and R. N. Kolesnick. 1996. Ceramide and the induction of apoptosis. Clin. Cancer Res. 2:1-6[Free Full Text].
23. Jones, P. F., T. Jakubowicz, F. J. Pitossi, F. Maurer, and B. A. Hemmings. 1991. Molecular cloning and identification of a serine/threonine protein kinase of the second-messenger subfamily. Proc. Natl. Acad. Sci. USA 88:4171-4175[Abstract/Free Full Text].
24. Kandror, K. V., L. Yu, and P. F. Pilch. 1994. The major protein of GLUT4-containing vesicles, gp160, has aminopeptidase activity. J. Biol. Chem. 269:30777-30780[Abstract/Free Full Text].
25. Kanety, H., R. Hemi, M. Z. Papa, and A. Karasik. 1996. Sphingomyelinase and ceramide suppress insulin-induced tyrosine phosphorylation of the insulin receptor substrate-1. J. Biol. Chem. 271:9895-9897[Abstract/Free Full Text].
26. Katagiri, H., T. Asano, H. Ishihara, K. Inukai, Y. Shibasaki, M. Kikuchi, Y. Yazaki, and Y. Oka. 1996. Overexpression of catalytic subunit p110 of phosphatidylinositol 3-kinase increases glucose transport activity with translocation of glucose transporters in 3T3-L1 adipocytes. J. Biol. Chem. 271:16987-16990[Abstract/Free Full Text].
27. Kohn, A. D., A. Boge, A. Barthel, K. Kovacina, B. Wallach, S. A. Summers, M. J. Birnbaum, and R. A. Roth. 1998. Construction and characterization of a conditionally active version of the ser/thr kinase Akt. J. Biol. Chem. 273:11937-11943[Abstract/Free Full Text].
28. Kohn, A. D., K. S. Kovacina, and R. A. Roth. 1995. Insulin stimulates the kinase activity of RAC-PK, a pleckstrin homology domain containing ser/thr kinase. EMBO J. 14:4288-4295[Medline].
29. Kohn, A. D., S. A. Summers, M. J. Birnbaum, and R. A. Roth. 1996. Expression of a constitutively active Akt Ser/Thr kinase in 3T3-L1 adipocytes stimulates glucose uptake and GLUT4 translocation. J. Biol. Chem. 271:31372-31378[Abstract/Free Full Text].
30. Konishi, H., T. Shinomura, S. Kuroda, Y. Ono, and U. Kikkawa. 1994. Molecular cloning of rat RAC protein kinase alpha and beta and their association with protein kinase C zeta. Biochem. Biophys. Res. Commun. 205:817-825[Medline].
31. Kotani, K., A. J. Carozzi, H. Sakaue, K. Hara, L. J. Robinson, S. F. Clark, K. Yonezawa, D. E. James, and M. Kasuga. 1995. Requirement for phosphoinositide 3-kinase in insulin-stimulated GLUT4 translocation in 3T3-L1 adipocytes. Biochem. Biophys. Res. Commun. 209:343-348[Medline].
32. Kowluru, A., and S. A. Metz. 1997. Ceramide-activated protein phosphatase-2A activity in insulin-secreting cells. FEBS Lett. 418:179-182[Medline].
33. Martin, S., T. Haruta, A. Morris, A. Klippel, L. Williams, and J. Olefsky. 1996. Activated phosphatidylinositol 3-kinase is sufficient to mediate actin rearrangement and GLUT4 translocation in 3T3-L1 adipocytes. J. Biol. Chem. 271:17605-17608[Abstract/Free Full Text].
34. Mastick, C. C., R. Aebersold, and G. E. Lienhard. 1994. Characterization of a major protein in GLUT4 vesicles. Concentration in the vesicles and insulin-stimulated translocation to the plasma membrane. J. Biol. Chem. 269:6089-6092[Abstract/Free Full Text].
35. Okada, T., Y. Kawano, T. Sabakibara, O. Hazeki, and M. Ui. 1994. Essential role of phosphatidylinositol 3-kinase in insulin-induced glucose transport and antilipolysis in rat adipocytes. Studies with a selective inhibitor, wortmannin. J. Biol. Chem. 269:3568-3573[Abstract/Free Full Text].
36. Pena, L. A., Z. Fuks, and R. Kolesnick. 1997. Stress-induced apoptosis and the sphingomyelin pathway. Biochem. Pharmacol. 53:615-621[Medline].
37. Peraldi, P., G. S. Hotamisligil, W. A. Buurman, M. F. White, and B. M. Spiegelman. 1996. Tumor necrosis factor (TNF)-alpha inhibits insulin signaling through stimulation of the p55 TNF receptor and activation of sphingomyelinase. J. Biol. Chem. 271:13018-13022[Abstract/Free Full Text].
38. Ross, S. A., H. M. Scott, N. J. Morris, W.-Y. Liung, F. Mao, G. E. Lienhard, and S. R. Keller. 1996. Characterization of the insulin-regulated membrane aminopeptidase in 3T3-L1 adipocytes. J. Biol. Chem. 271:3328-3332[Abstract/Free Full Text].
39. Shimabukuro, M., Y.-T. Zhou, M. Levi, and R. H. Unger. 1998. Fatty acid-induced beta  cell apoptosis: a link between obesity and diabetes. Proc. Natl. Acad. Sci. USA 95:2498-2502[Abstract/Free Full Text].
40. Stempka, L., A. Girod, H.-J. Muller, G. Rincke, F. Marks, M. Gschwendt, and D. Bossemeyer. 1997. Phosphorylation of protein kinase Cdelta (PKCdelta ) at threonine 505 is not a prerequisite for enzymatic activity. Expression of rat PKCdelta and alanine 505 mutant in bacteria in a functional form. J. Biol. Chem. 272:6805-6811[Abstract/Free Full Text].
41. Summers, S. A., and M. J. Birnbaum. 1997. A role for the serine/threonine kinase, Akt, in insulin-stimulated glucose uptake. Biochem. Soc. Trans. 25:981-988[Medline].
42. Summers, S. A., and M. J. Birnbaum. Unpublished data.
43. Summers, S. A., L. Lipfert, and M. J. Birnbaum. 1998. Polyoma middle T antigen activates the serine/threonine kinase Akt in a PI3-kinase dependent manner. Biochem. Biophys. Res. Commun. 246:76-81[Medline].
44. Sun, X. J., P. Rothenberg, C. R. Kahn, J. M. Backer, E. Araki, P. A. Wilden, D. A. Cahill, B. J. Goldstein, and M. F. White. 1991. Structure of the insulin receptor substrate IRS-1 defines a unique signal transduction protein. Nature 352:73-77[Medline].
45. Tanti, J. F., S. Grillo, T. Gremeaux, P. J. Coffer, E. Van Obberghen, and Y. Le Marchand-Brustel. 1997. Potential role of protein kinase B in glucose transporter 4 translocation in adipocytes. Endocrinology 138:2005-2010[Abstract/Free Full Text].
46. Turinsky, J., D. M. O'Sullivan, and B. P. Bayly. 1990. 1,2-Diacylglycerol and ceramide levels in insulin-resistant tissues of the rat in vivo. J. Biol. Chem. 265:16880-16885[Abstract/Free Full Text].
47. Ueki, K., R. Yamamoto-Honda, Y. Kaburagi, T. Yamauchi, K. Tobe, B. M. T. Burgering, P. J. Coffer, I. Komuro, Y. Akanuma, Y. Yazaki, and T. Kadowaki. 1998. Potential role of protein kinase B in insulin-induced glucose transport, glycogen synthesis, and protein synthesis. J. Biol. Chem. 273:5315-5322[Abstract/Free Full Text].
48. Wang, C.-N., L. O'Brien, and D. N. Brindley. 1998. Effects of cell-permeable ceramides and tumor necrosis factor-alpha on insulin signaling and glucose uptake in 3T3-L1 adipocytes. Diabetes 47:24-31[Abstract].
49. Yeh, J. I., E. A. Gulve, L. Rameh, and M. J. Birnbaum. 1995. The effects of wortmannin on rat skeletal muscle. Dissociation of signaling pathways for insulin- and contraction-activated hexose transport. J. Biol. Chem. 270:2107-2111[Abstract/Free Full Text].


Molecular and Cellular Biology, September 1998, p. 5457-5464, Vol. 18, No. 9
0270-7306/98/$04.00+0
Copyright © 1998, American Society for Microbiology. All rights reserved.



This article has been cited by other articles:

  • Liu, L., Shi, X., Choi, C. S., Shulman, G. I., Klaus, K., Nair, K. S., Schwartz, G. J., Zhang, Y., Goldberg, I. J., Yu, Y.-H. (2009). Paradoxical Coupling of Triglyceride Synthesis and Fatty Acid Oxidation in Skeletal Muscle Overexpressing DGAT1. Diabetes 58: 2516-2524 [Abstract] [Full Text]  
  • Fontes, G., Semache, M., Hagman, D. K., Tremblay, C., Shah, R., Rhodes, C. J., Rutter, J., Poitout, V. (2009). Involvement of Per-Arnt-Sim Kinase and Extracellular-Regulated Kinases-1/2 in Palmitate Inhibition of Insulin Gene Expression in Pancreatic {beta}-Cells. Diabetes 58: 2048-2058 [Abstract] [Full Text]  
  • Shi, Y., Cheng, D. (2009). Beyond triglyceride synthesis: the dynamic functional roles of MGAT and DGAT enzymes in energy metabolism. Am. J. Physiol. Endocrinol. Metab. 297: E10-E18 [Abstract] [Full Text]  
  • Kachko, I., Maissel, A., Mazor, L., Ben-Romano, R., Watson, R. T., Hou, J. C., Pessin, J. E., Bashan, N., Rudich, A. (2009). Postreceptoral Adipocyte Insulin Resistance Induced by Nelfinavir Is Caused by Insensitivity of PKB/Akt to Phosphatidylinositol-3,4,5-Trisphosphate. Endocrinology 150: 2618-2626 [Abstract] [Full Text]  
  • Junkin, K. A., Dyck, D. J., Mullen, K. L., Chabowski, A., Thrush, A. B. (2009). Resistin acutely impairs insulin-stimulated glucose transport in rodent muscle in the presence, but not absence, of palmitate. Am. J. Physiol. Regul. Integr. Comp. Physiol. 296: R944-R951 [Abstract] [Full Text]  
  • Attie, A. D., Scherer, P. E. (2009). Adipocyte metabolism and obesity. J. Lipid Res. 50: S395-S399 [Abstract] [Full Text]  
  • Kaifu, K., Kiyomoto, H., Hitomi, H., Matsubara, K., Hara, T., Moriwaki, K., Ihara, G., Fujita, Y., Sugasawa, N., Nagata, D., Nishiyama, A., Kohno, M. (2009). Insulin attenuates apoptosis induced by high glucose via the PI3-kinase/Akt pathway in rat peritoneal mesothelial cells. Nephrol Dial Transplant 24: 809-815 [Abstract] [Full Text]  
  • Bruce, C. R., Hoy, A. J., Turner, N., Watt, M. J., Allen, T. L., Carpenter, K., Cooney, G. J., Febbraio, M. A., Kraegen, E. W. (2009). Overexpression of Carnitine Palmitoyltransferase-1 in Skeletal Muscle Is Sufficient to Enhance Fatty Acid Oxidation and Improve High-Fat Diet-Induced Insulin Resistance. Diabetes 58: 550-558 [Abstract] [Full Text]  
  • Bonzon-Kulichenko, E., Schwudke, D., Gallardo, N., Molto, E., Fernandez-Agullo, T., Shevchenko, A., Andres, A. (2009). Central Leptin Regulates Total Ceramide Content and Sterol Regulatory Element Binding Protein-1C Proteolytic Maturation in Rat White Adipose Tissue. Endocrinology 150: 169-178 [Abstract] [Full Text]  
  • Samokhvalov, V., Bilan, P. J., Schertzer, J. D., Antonescu, C. N., Klip, A. (2009). Palmitate- and lipopolysaccharide-activated macrophages evoke contrasting insulin responses in muscle cells. Am. J. Physiol. Endocrinol. Metab. 296: E37-E46 [Abstract] [Full Text]  
  • Park, T.-S., Hu, Y., Noh, H.-L., Drosatos, K., Okajima, K., Buchanan, J., Tuinei, J., Homma, S., Jiang, X.-C., Abel, E. D., Goldberg, I. J. (2008). Ceramide is a cardiotoxin in lipotoxic cardiomyopathy. J. Lipid Res. 49: 2101-2112 [Abstract] [Full Text]  
  • Poitout, V., Robertson, R. P. (2008). Glucolipotoxicity: Fuel Excess and {beta}-Cell Dysfunction. Endocr. Rev. 29: 351-366 [Abstract] [Full Text]  
  • Mott, D. M., Stone, K., Gessel, M. C., Bunt, J. C., Bogardus, C. (2008). Palmitate action to inhibit glycogen synthase and stimulate protein phosphatase 2A increases with risk factors for type 2 diabetes. Am. J. Physiol. Endocrinol. Metab. 294: E444-E450 [Abstract] [Full Text]  
  • Wu, D., Ren, Z., Pae, M., Guo, W., Cui, X., Merrill, A. H., Meydani, S. N. (2007). Aging Up-Regulates Expression of Inflammatory Mediators in Mouse Adipose Tissue. J. Immunol. 179: 4829-4839 [Abstract] [Full Text]  
  • Smith, A. C., Mullen, K. L., Junkin, K. A., Nickerson, J., Chabowski, A., Bonen, A., Dyck, D. J. (2007). Metformin and exercise reduce muscle FAT/CD36 and lipid accumulation and blunt the progression of high-fat diet-induced hyperglycemia. Am. J. Physiol. Endocrinol. Metab. 293: E172-E181 [Abstract] [Full Text]  
  • Zhao, H., Przybylska, M., Wu, I-H., Zhang, J., Siegel, C., Komarnitsky, S., Yew, N. S., Cheng, S. H. (2007). Inhibiting Glycosphingolipid Synthesis Improves Glycemic Control and Insulin Sensitivity in Animal Models of Type 2 Diabetes. Diabetes 56: 1210-1218 [Abstract] [Full Text]  
  • Corcoran, M. P, Lamon-Fava, S., Fielding, R. A (2007). Skeletal muscle lipid deposition and insulin resistance: effect of dietary fatty acids and exercise. Am. J. Clin. Nutr. 85: 662-677 [Abstract] [Full Text]  
  • Ghosh, N., Patel, N., Jiang, K., Watson, J. E., Cheng, J., Chalfant, C. E., Cooper, D. R. (2007). Ceramide-Activated Protein Phosphatase Involvement in Insulin Resistance via Akt, Serine/Arginine-Rich Protein 40, and Ribonucleic Acid Splicing in L6 Skeletal Muscle Cells. Endocrinology 148: 1359-1366 [Abstract] [Full Text]  
  • Bonen, A., Chabowski, A., Luiken, J. J. F. P, Glatz, J. F. C. (2007). Mechanisms and Regulation of Protein-Mediated Cellular Fatty Acid Uptake: Molecular, Biochemical, and Physiological Evidence. Physiology 22: 15-28 [Full Text]  
  • JeBailey, L., Wanono, O., Niu, W., Roessler, J., Rudich, A., Klip, A. (2007). Ceramide- and Oxidant-Induced Insulin Resistance Involve Loss of Insulin-Dependent Rac-Activation and Actin Remodeling in Muscle Cells. Diabetes 56: 394-403 [Abstract] [Full Text]  
  • Morino, K., Petersen, K. F., Shulman, G. I. (2006). Molecular Mechanisms of Insulin Resistance in Humans and Their Potential Links With Mitochondrial Dysfunction. Diabetes 55: S9-S15 [Abstract] [Full Text]  
  • MacRae, V E, Burdon, T, Ahmed, S F, Farquharson, C (2006). Ceramide inhibition of chondrocyte proliferation and bone growth is IGF-I independent.. J Endocrinol 191: 369-377 [Abstract] [Full Text]  
  • Orisaka, M., Orisaka, S., Jiang, J.-Y., Craig, J., Wang, Y., Kotsuji, F., Tsang, B. K. (2006). Growth Differentiation Factor 9 Is Antiapoptotic during Follicular Development from Preantral to Early Antral Stage. Mol. Endocrinol. 20: 2456-2468 [Abstract] [Full Text]  
  • Bruce, C. R., Thrush, A. B., Mertz, V. A., Bezaire, V., Chabowski, A., Heigenhauser, G. J. F., Dyck, D. J. (2006). Endurance training in obese humans improves glucose tolerance and mitochondrial fatty acid oxidation and alters muscle lipid content. Am. J. Physiol. Endocrinol. Metab. 291: E99-E107 [Abstract] [Full Text]  
  • Thirone, A. C.P., JeBailey, L., Bilan, P. J., Klip, A. (2006). Opposite Effect of JAK2 on Insulin-Dependent Activation of Mitogen-Activated Protein Kinases and Akt in Muscle Cells: Possible Target to Ameliorate Insulin Resistance.. Diabetes 55: 942-951 [Abstract] [Full Text]  
  • Rodriguez-Lee, M., Ostergren-Lunden, G., Wallin, B., Moses, J., Bondjers, G., Camejo, G. (2006). Fatty Acids Cause Alterations of Human Arterial Smooth Muscle Cell Proteoglycans That Increase the Affinity for Low-Density Lipoprotein. Arterioscler. Thromb. Vasc. Bio. 26: 130-135 [Abstract] [Full Text]  
  • Belfort, R., Mandarino, L., Kashyap, S., Wirfel, K., Pratipanawatr, T., Berria, R., DeFronzo, R. A., Cusi, K. (2005). Dose-Response Effect of Elevated Plasma Free Fatty Acid on Insulin Signaling. Diabetes 54: 1640-1648 [Abstract] [Full Text]  
  • Chavez, J. A., Holland, W. L., Bar, J., Sandhoff, K., Summers, S. A. (2005). Acid Ceramidase Overexpression Prevents the Inhibitory Effects of Saturated Fatty Acids on Insulin Signaling. J. Biol. Chem. 280: 20148-20153 [Abstract] [Full Text]  
  • Summers, S. A., Nelson, D. H. (2005). A Role for Sphingolipids in Producing the Common Features of Type 2 Diabetes, Metabolic Syndrome X, and Cushing's Syndrome. Diabetes 54: 591-602 [Abstract] [Full Text]  
  • Gaster, M., Rustan, A. C., Beck-Nielsen, H. (2005). Differential Utilization of Saturated Palmitate and Unsaturated Oleate: Evidence From Cultured Myotubes. Diabetes 54: 648-656 [Abstract] [Full Text]  
  • Dobrzyn, A., Dobrzyn, P., Lee, S.-H., Miyazaki, M., Cohen, P., Asilmaz, E., Hardie, D. G., Friedman, J. M., Ntambi, J. M. (2005). Stearoyl-CoA desaturase-1 deficiency reduces ceramide synthesis by downregulating serine palmitoyltransferase and increasing {beta}-oxidation in skeletal muscle. Am. J. Physiol. Endocrinol. Metab. 288: E599-E607 [Abstract] [Full Text]  
  • Bruce, C. R., Dyck, D. J. (2004). Cytokine regulation of skeletal muscle fatty acid metabolism: effect of interleukin-6 and tumor necrosis factor-{alpha}. Am. J. Physiol. Endocrinol. Metab. 287: E616-E621 [Abstract] [Full Text]  
  • Stratford, S., Hoehn, K. L., Liu, F., Summers, S. A. (2004). Regulation of Insulin Action by Ceramide: DUAL MECHANISMS LINKING CERAMIDE ACCUMULATION TO THE INHIBITION OF Akt/PROTEIN KINASE B. J. Biol. Chem. 279: 36608-36615 [Abstract] [Full Text]  
  • Gross, D. N., Farmer, S. R., Pilch, P. F. (2004). Glut4 Storage Vesicles without Glut4: Transcriptional Regulation of Insulin-Dependent Vesicular Traffic. Mol. Cell. Biol. 24: 7151-7162 [Abstract] [Full Text]  
  • Weyrich, P., Kapp, K., Niederfellner, G., Melzer, M., Lehmann, R., Haring, H.-U., Lammers, R. (2004). Partitioning-Defective Protein 6 Regulates Insulin-Dependent Glycogen Synthesis via Atypical Protein Kinase C. Mol. Endocrinol. 18: 1287-1300 [Abstract] [Full Text]  
  • Straczkowski, M., Kowalska, I., Nikolajuk, A., Dzienis-Straczkowska, S., Kinalska, I., Baranowski, M., Zendzian-Piotrowska, M., Brzezinska, Z., Gorski, J. (2004). Relationship Between Insulin Sensitivity and Sphingomyelin Signaling Pathway in Human Skeletal Muscle. Diabetes 53: 1215-1221 [Abstract] [Full Text]  
  • Scarlatti, F., Bauvy, C., Ventruti, A., Sala, G., Cluzeaud, F., Vandewalle, A., Ghidoni, R., Codogno, P. (2004). Ceramide-mediated Macroautophagy Involves Inhibition of Protein Kinase B and Up-regulation of Beclin 1. J. Biol. Chem. 279: 18384-18391 [Abstract] [Full Text]  
  • Adams, J. M. II, Pratipanawatr, T., Berria, R., Wang, E., DeFronzo, R. A., Sullards, M. C., Mandarino, L. J. (2004). Ceramide Content Is Increased in Skeletal Muscle From Obese Insulin-Resistant Humans. Diabetes 53: 25-31 [Abstract] [Full Text]  
  • Powell, D. J., Hajduch, E., Kular, G., Hundal, H. S. (2003). Ceramide Disables 3-Phosphoinositide Binding to the Pleckstrin Homology Domain of Protein Kinase B (PKB)/Akt by a PKC{zeta}-Dependent Mechanism. Mol. Cell. Biol. 23: 7794-7808 [Abstract] [Full Text]  
  • Bruce, C. R., Anderson, M. J., Carey, A. L., Newman, D. G., Bonen, A., Kriketos, A. D., Cooney, G. J., Hawley, J. A. (2003). Muscle Oxidative Capacity Is a Better Predictor of Insulin Sensitivity than Lipid Status. J. Clin. Endocrinol. Metab. 88: 5444-5451 [Abstract] [Full Text]  
  • Tessier, J.-P., Thurner, B., Jungling, E., Luckhoff, A., Fischer, Y. (2003). Impairment of glucose metabolism in hearts from rats treated with endotoxin. Cardiovasc Res 60: 119-130 [Abstract] [Full Text]  
  • Schlaepfer, I. R., Pulawa, L. K., Ferreira, L. D. M. C-B., James, D. E., Capell, W. H., Eckel, R. H. (2003). Increased expression of the SNARE accessory protein Munc18c in lipid-mediated insulin resistance. J. Lipid Res. 44: 1174-1181 [Abstract] [Full Text]  
  • Chavez, J. A., Knotts, T. A., Wang, L.-P., Li, G., Dobrowsky, R. T., Florant, G. L., Summers, S. A. (2003). A Role for Ceramide, but Not Diacylglycerol, in the Antagonism of Insulin Signal Transduction by Saturated Fatty Acids. J. Biol. Chem. 278: 10297-10303 [Abstract] [Full Text]  
  • Wrede, C. E., Dickson, L. M., Lingohr, M. K., Briaud, I., Rhodes, C. J. (2002). Protein Kinase B/Akt Prevents Fatty Acid-induced Apoptosis in Pancreatic beta -Cells (INS-1). J. Biol. Chem. 277: 49676-49684 [Abstract] [Full Text]  
  • Martin, D., Salinas, M., Fujita, N., Tsuruo, T., Cuadrado, A. (2002). Ceramide and Reactive Oxygen Species Generated by H2O2 Induce Caspase-3-independent Degradation of Akt/Protein Kinase B. J. Biol. Chem. 277: 42943-42952 [Abstract] [Full Text]  
  • Ho, R. C., Davy, K. P., Hickey, M. S., Summers, S. A., Melby, C. L. (2002). Behavioral, metabolic, and molecular correlates of lower insulin sensitivity in Mexican-Americans. Am. J. Physiol. Endocrinol. Metab. 283: E799-E808 [Abstract] [Full Text]  
  • Hannun, Y. A., Obeid, L. M. (2002). The Ceramide-centric Universe of Lipid-mediated Cell Regulation: Stress Encounters of the Lipid Kind. J. Biol. Chem. 277: 25847-25850 [Full Text]  
  • Yu, Y., Alwine, J. C. (2002). Human Cytomegalovirus Major Immediate-Early Proteins and Simian Virus 40 Large T Antigen Can Inhibit Apoptosis through Activation of the Phosphatidylinositide 3'-OH Kinase Pathway and the Cellular Kinase Akt. J. Virol. 76: 3731-3738 [Abstract] [Full Text]  
  • Mei, J., Holst, L. S., Landstrom, T. R., Holm, C., Brindley, D., Manganiello, V., Degerman, E. (2002). C2-Ceramide Influences the Expression and Insulin-Mediated Regulation of Cyclic Nucleotide Phosphodiesterase 3B and Lipolysis in 3T3-L1 Adipocytes. Diabetes 51: 631-637 [Abstract] [Full Text]  
  • Bourbon, N. A., Sandirasegarane, L., Kester, M. (2002). Ceramide-induced Inhibition of Akt Is Mediated through Protein Kinase Czeta . IMPLICATIONS FOR GROWTH ARREST. J. Biol. Chem. 277: 3286-3292 [Abstract] [Full Text]  
  • Kralik, S. F., Liu, P., Leffler, B. J., Elmendorf, J. S. (2002). Ceramide and Glucosamine Antagonism of Alternate Signaling Pathways Regulating Insulin- and Osmotic Shock-Induced Glucose Transporter 4 Translocation. Endocrinology 143: 37-46 [Abstract] [Full Text]  
  • Tenzer, A., Zingg, D., Rocha, S., Hemmings, B., Fabbro, D., Glanzmann, C., Schubiger, P. A., Bodis, S., Pruschy, M. (2001). The Phosphatidylinositide 3'-Kinase/Akt Survival Pathway Is a Target for the Anticancer and Radiosensitizing Agent PKC412, an Inhibitor of Protein Kinase C. Cancer Res. 61: 8203-8210 [Abstract] [Full Text]  
  • Teruel, T., Hernandez, R., Lorenzo, M. (2001). Ceramide Mediates Insulin Resistance by Tumor Necrosis Factor-{alpha} in Brown Adipocytes by Maintaining Akt in an Inactive Dephosphorylated State. Diabetes 50: 2563-2571 [Abstract] [Full Text]  
  • Cazzolli, R., Carpenter, L., Biden, T. J., Schmitz-Peiffer, C. (2001). A Role for Protein Phosphatase 2A-Like Activity, but Not Atypical Protein Kinase C{zeta}, in the Inhibition of Protein Kinase B/Akt and Glycogen Synthesis by Palmitate. Diabetes 50: 2210-2218 [Abstract] [Full Text]  
  • Kim, J. K., Fillmore, J. J., Chen, Y., Yu, C., Moore, I. K., Pypaert, M., Lutz, E. P., Kako, Y., Velez-Carrasco, W., Goldberg, I. J., Breslow, J. L., Shulman, G. I. (2001). Tissue-specific overexpression of lipoprotein lipase causes tissue-specific insulin resistance. Proc. Natl. Acad. Sci. USA 10.1073/pnas.121164498v1 [Abstract] [Full Text]  
  • Charles, R., Sandirasegarane, L., Yun, J., Bourbon, N., Wilson, R., Rothstein, R. P., Levison, S. W., Kester, M. (2000). Ceramide-Coated Balloon Catheters Limit Neointimal Hyperplasia After Stretch Injury in Carotid Arteries. Circ. Res. 87: 282-288 [Abstract] [Full Text]  
  • Sandirasegarane, L., Charles, R., Bourbon, N., Kester, M. (2000). NO regulates PDGF-induced activation of PKB but not ERK in A7r5 cells: implications for vascular growth arrest. Am. J. Physiol. Cell Physiol. 279: C225-C235 [Abstract] [Full Text]  
  • Schubert, K. M., Scheid, M. P., Duronio, V. (2000). Ceramide Inhibits Protein Kinase B/Akt by Promoting Dephosphorylation of Serine 473. J. Biol. Chem. 275: 13330-13335 [Abstract] [Full Text]  
  • Burow, M. E., Weldon, C. B., Collins-Burow, B. M., Ramsey, N., McKee, A., Klippel, A., McLachlan, J. A., Clejan, S., Beckman, B. S. (2000). Cross-talk between Phosphatidylinositol 3-Kinase and Sphingomyelinase Pathways as a Mechanism for Cell Survival/Death Decisions. J. Biol. Chem. 275: 9628-9635 [Abstract] [Full Text]  
  • Kanzaki, M., Watson, R. T., Artemyev, N. O., Pessin, J. E. (2000). The Trimeric GTP-binding Protein (Gq/G11) alpha Subunit Is Required for Insulin-stimulated GLUT4 Translocation in 3T3L1 Adipocytes. J. Biol. Chem. 275: 7167-7175 [Abstract] [Full Text]  
  • Zundel, W., Swiersz, L. M., Giaccia, A. (2000). Caveolin 1-Mediated Regulation of Receptor Tyrosine Kinase-Associated Phosphatidylinositol 3-Kinase Activity by Ceramide. Mol. Cell. Biol. 20: 1507-1514 [Abstract] [Full Text]  
  • Hermann, C., Assmus, B., Urbich, C., Zeiher, A. M., Dimmeler, S. (2000). Insulin-Mediated Stimulation of Protein Kinase Akt : A Potent Survival Signaling Cascade for Endothelial Cells. Arterioscler. Thromb. Vasc. Bio. 20: 402-409 [Abstract] [Full Text]  
  • Garza, L. A., Birnbaum, M. J. (2000). Insulin-responsive Aminopeptidase Trafficking in 3T3-L1 Adipocytes. J. Biol. Chem. 275: 2560-2567 [Abstract] [Full Text]  
  • Datta, S. R., Brunet, A., Greenberg, M. E. (1999). Cellular survival: a play in three Akts. Genes Dev. 13: 2905-2927 [Full Text]  
  • Hausdorff, S. F., Fingar, D. C., Morioka, K., Garza, L. A., Whiteman, E. L., Summers, S. A., Birnbaum, M. J. (1999). Identification of Wortmannin-sensitive Targets in 3T3-L1 Adipocytes. DISSOCIATION OF INSULIN-STIMULATED GLUCOSE UPTAKE AND GLUT4 TRANSLOCATION. J. Biol. Chem. 274: 24677-24684 [Abstract] [Full Text]  
  • Summers, S. A., Whiteman, E. L., Cho, H., Lipfert, L., Birnbaum, M. J. (1999). Differentiation-dependent Suppression of Platelet-derived Growth Factor Signaling in Cultured Adipocytes. J. Biol. Chem. 274: 23858-23867 [Abstract] [Full Text]  
  • Schmitz-Peiffer, C., Craig, D. L., Biden, T. J. (1999). Ceramide Generation Is Sufficient to Account for the Inhibition of the Insulin-stimulated PKB Pathway in C2C12 Skeletal Muscle Cells Pretreated with Palmitate. J. Biol. Chem. 274: 24202-24210 [Abstract] [Full Text]  
  • Scaffidi, C., Schmitz, I., Zha, J., Korsmeyer, S. J., Krammer, P. H., Peter, M. E. (1999). Differential Modulation of Apoptosis Sensitivity in CD95 Type I and Type II Cells. J. Biol. Chem. 274: 22532-22538 [Abstract] [Full Text]  
  • Doornbos, R. P., Theelen, M., van der Hoeven, P. C. J., van Blitterswijk, W. J., Verkleij, A. J., van Bergen en Henegouwen, P. M. P. (1999). Protein Kinase Czeta Is a Negative Regulator of Protein Kinase B Activity. J. Biol. Chem. 274: 8589-8596 [Abstract] [Full Text]  
  • Kupriyanova, T. A., Kandror, K. V. (1999). Akt-2 Binds to Glut4-containing Vesicles and Phosphorylates Their Component Proteins in Response to Insulin. J. Biol. Chem. 274: 1458-1464 [Abstract] [Full Text]  
  • Lee, J. Y., Hannun, Y. A., Obeid, L. M. (2000). Functional Dichotomy of Protein Kinase C (PKC) in Tumor Necrosis Factor-alpha (TNF-alpha ) Signal Transduction in L929 Cells. TRANSLOCATION AND INACTIVATION OF PKC BY TNF-alpha. J. Biol. Chem. 275: 29290-29298 [Abstract] [Full Text]  
  • Koh, H., Lee, K. H., Kim, D., Kim, S., Kim, J. W., Chung, J. (2000). Inhibition of Akt and Its Anti-apoptotic Activities by Tumor Necrosis Factor-induced Protein Kinase C-related Kinase 2 (PRK2) Cleavage. J. Biol. Chem. 275: 34451-34458 [Abstract] [Full Text]  
  • Wick, M. J., Dong, L. Q., Riojas, R. A., Ramos, F. J., Liu, F. (2000). Mechanism of Phosphorylation of Protein Kinase B/Akt by a Constitutively Active 3-Phosphoinositide-dependent Protein Kinase-1. J. Biol. Chem. 275: 40400-40406 [Abstract] [Full Text]  
  • Mathieu, A.-L., Gonin, S., Leverrier, Y., Blanquier, B., Thomas, J., Dantin, C., Martin, G., Baverel, G., Marvel, J. (2001). Activation of the Phosphatidylinositol 3-Kinase/Akt Pathway Protects against Interleukin-3 Starvation but Not DNA Damage-induced Apoptosis. J. Biol. Chem. 276: 10935-10942 [Abstract] [Full Text]  
  • Kim, J. K., Fillmore, J. J., Chen, Y., Yu, C., Moore, I. K., Pypaert, M., Lutz, E. P., Kako, Y., Velez-Carrasco, W., Goldberg, I. J., Breslow, J. L., Shulman, G. I. (2001). Tissue-specific overexpression of lipoprotein lipase causes tissue-specific insulin resistance. Proc. Natl. Acad. Sci. USA 98: 7522-7527 [Abstract] [Full Text]  
  • Nelson, B. A., Robinson, K. A., Buse, M. G. (2002). Defective Akt activation is associated with glucose- but not glucosamine-induced insulin resistance. Am. J. Physiol. Endocrinol. Metab. 282: E497-E506 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Summers, S. A.
Right arrow Articles by Birnbaum, M. J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Summers, S. A.
Right arrow Articles by Birnbaum, M. J.