Previous Article | Next Article 
Molecular and Cellular Biology, February 1999, p. 1508-1517, Vol. 19, No. 2
0270-7306/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
Cell-Type-Dependent Activity of the Ubiquitous
Transcription Factor USF in Cellular Proliferation and
Transcriptional Activation
Yibing
Qyang,1
Xu
Luo,1,
Tao
Lu,1
Preeti M.
Ismail,1
Dmitry
Krylov,2
Charles
Vinson,2 and
Michèle
Sawadogo1,*
Department of Molecular Genetics, University
of Texas M. D. Anderson Cancer Center, Houston, Texas
77030,1 and
Laboratory of Biochemistry,
National Cancer Institute, Bethesda, Maryland 208922
Received 29 September 1997/Returned for modification 8 November
1997/Accepted 4 November 1998
 |
ABSTRACT |
USF1 and USF2 are basic helix-loop-helix transcription factors
implicated in the control of cellular proliferation. In HeLa cells, the
USF proteins are transcriptionally active and their overexpression
causes marked growth inhibition. In contrast, USF overexpression had
essentially no effect on the proliferation of the Saos-2 osteosarcoma
cell line. USF1 and USF2 also lacked transcriptional activity in Saos-2
cells when assayed by transient cotransfection with USF-dependent
reporter genes. Yet, there was no difference in the expression,
subcellular localization, or DNA-binding activity of the USF proteins
in HeLa and Saos-2 cells. Furthermore, Gal4-USF1 and Gal4-USF2 fusion
proteins activated transcription similarly in both cell lines.
Mutational analysis and domain swapping experiments revealed that the
small, highly conserved USF-specific region (USR) was responsible for
the inactivity of USF in Saos-2 cells. In HeLa, the USR serves a dual
function. It acts as an autonomous transcriptional activation domain at promoters containing an initiator element and also induces a
conformational change that is required for USF activity at promoters
lacking an initiator. Taken together, these results suggest a model in which the transcriptional activity of the USF proteins, and
consequently their antiproliferative activity, is tightly controlled by
interaction with a specialized coactivator that recognizes the
conserved USR domain and, in contrast to USF, is not ubiquitous. The
activity of USF is therefore context dependent, and evidence for USF
DNA-binding activity in particular cells is insufficient to indicate
USF function in transcriptional activation and growth control.
 |
INTRODUCTION |
USF is a family of evolutionarily
conserved basic-helix-loop-helix-leucine zipper (bHLH-zip)
transcription factors (8, 11, 17, 36) that interact with the
DNA at symmetrical E boxes with the consensus sequence 5'
GGTCACGTGACC 3' (2). In mammals, there are two
ubiquitously expressed genes, USF1 and USF2, that
play an essential role during embryonic development and also have
pleiotropic effects in adult animals (10, 21, 37, 38).
One noticeable feature of the USF proteins is that they share with the
Myc oncoproteins both a similar polypeptide structure and a similar
DNA-binding specificity (2, 3, 14, 25). Yet, the cellular
functions of USF and Myc seem quite different. For example,
overexpression of c-myc, in collaboration with a second
oncogene, is sufficient to trigger the complete transformation of
primary embryo fibroblasts (20). Overexpression of USF can specifically abolish this transforming ability of c-Myc
(22). Similarly, while c-Myc overexpression often
contributes to the rapid proliferation of tumor cells, USF
overexpression has instead been found to inhibit growth in a number of
cancer cell lines (16, 22). Together, these observations
suggest that USF and Myc play antagonistic roles in the control of
mammalian cell proliferation.
The USF1 and USF2 polypeptides are very similar in their C-terminal
regions, which contain the bHLH-zip domain, and consequently display
identical dimerization and DNA-binding specificities (35, 36). Also extremely conserved between USF1 and USF2 is a small domain, termed the USF-specific region (USR), that is apparently unique
to the USF proteins. The USR, which is located just upstream of the
basic region, is essential for transcriptional activation by USF at
promoters containing both a TATA box and an initiator element
(23). The amino acid sequences of USF1 and USF2 are considerably more divergent in their N-terminal regions, which include
in each case at least one other transcriptional activation domain
(15, 23). The major USF species present in most tissues and
cell lines is the heterodimer between USF1 and USF2. USF1 homodimers
are less abundant, and USF2 homodimers are usually quite scarce
(36, 37, 39).
Identification of cellular genes that are regulated by USF is
complicated by the fact that most USF binding sites can also be
recognized by other helix-loop-helix proteins, including all of the Myc
(4, 14) and TFE3 (1, 7) family members. In
addition, given their similarities but also their differences, various
USF dimers may have both common and unique target genes (37). Among the proposed USF targets, it is noteworthy that many, including p53, transforming growth factor
2, and cyclin B1,
are genes themselves involved in proliferation or cell cycle control
(6, 27, 31).
While investigating the transcriptional and growth inhibitory
properties of USF, we discovered that although the DNA-binding activity
of USF was present in every cell line and tissue investigated, the
transcriptional activities of the USF proteins varied. Here we report
an analysis of the loss of USF function in the Saos-2 osteosarcoma cell
line. The results of this analysis strongly suggest the existence of at
least one additional protein, functioning as a specialized coactivator,
that is absolutely required for USF function and, in contrast to USF
itself, is not ubiquitously expressed.
 |
MATERIALS AND METHODS |
Cell culture and transfections.
The Saos-2 cell line was
obtained from the American Type Culture Collection (Rockville, Md.).
Both HeLa and Saos-2 cells were maintained in Dulbecco's modified
Eagle medium supplemented with 10% donor calf serum (Sigma). HeLa
cells were transfected by the calcium phosphate precipitation method as
previously described (23). For Saos-2 cells, the
transfection procedure was optimized by leaving the precipitate in
contact with the cells for only 5 h in a 5% CO2
incubator. To compare results between the two cell lines, cotransfected
plasmids included in each case 2.2 µg of pSV40-
-galactosidase as
an internal control and the amounts of extracts used for
electrophoretic mobility shift assay (EMSA) and Western blot analysis
were normalized to equal
-galactosidase units. Luciferase and
chloramphenicol acetyltransferase (CAT) assays were carried out as
previously described (23).
For colony formation assay, the cells were transfected with 2 µg of
pSV2neo and 6 µg of either pSG5, psvUSF1, or psvUSF2 (23, 24). After 3 weeks of selection in G418 (400 µg/ml), resistant colonies were stained with crystal violet and counted.
Plasmids.
Reporter plasmids were as described previously
(24, 23). Derivation of the expression vectors for USF2
B,
U2
N, U2
(7-186), U2
USR, and G-U2(96-199) (Gal4-USF2) has also
been previously reported (23). Construction of the USF2-VP16
expression vector, a generous gift from Howard Towle (University of
Minnesota), is described in the work of Kayto et al. (12).
Plasmid G-U1NS (Gal4-USF1) was constructed by inserting the end-filled
NarI-to-ScaI fragment of the USF1 cDNA into the
SmaI site of a pSG424 vector (29). The resulting
Gal4-USF1 fusion protein therefore contained amino acids 80 to 169 of
human USF1 downstream of the DNA-binding domain of Gal4 comprising
amino acids 1 to 147. For construction of the U2
E5 mutant lacking
amino acids 144 to 188 of USF2, restriction sites for NheI
were introduced on each side of the exon 5 region in psvUSF2 by using
the Transformer Site-Directed Mutagenesis kit (Clontech). The exon 5 region was then excised from the resulting plasmid by cleavage with
NheI followed by intramolecular religation. For construction
of pUSF2-TFE3, a DNA fragment encoding the bHLH-zip region of TFE3
(amino acids 130 to 234) was amplified by PCR using primers containing
XhoI sites. The PCR product was then polymerized, cut with
XhoI, and cloned into an XhoI-cut psvUSF2 vector.
The same strategy was used to construct the E5-USF2 expression plasmid with a BamHI-restricted PCR fragment encoding amino acids
142 to 199 of USF2 that was cloned into a BamH1-cut psvUSF2
vector. The construction of all new plasmids was verified by DNA sequencing.
Construction and characterization of A-USF.
The USF
dominant-negative mutant (A-USF) coding sequence was cloned as an
NdeI-HindIII fragment into a pRc/CMV vector
(Invitrogen) modified to contain an N-terminal hemagglutinin epitope
(MYPYDVPDYA) and a new polylinker (pRc/CMV566). The protein sequence of
A-USF is
MAYPYDVPDYAHM-ASMTGGQQMGR-DPDE EEDDE EELE EDLENWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQE LRQS N H RLSE E LQGLDQLQLDNDVLRQQVE DLKNKNLLLRAQLRHHGLEVVIKNDSN, where the bold letters are the acidic extension. The extent and specificity of the inhibition of USF DNA binding by A-USF were examined
by EMSA (Fig. 1). This analysis revealed
that one molar equivalent of A-USF inhibited USF DNA binding very
strongly (more than fourfold) and three molar equivalents essentially
abolished USF DNA binding. As a control, other bHLH-zip
dominant-negative mutants containing the same acidic extension adjacent
to the helix-loop-helix of Mitf (7, 9), or Max
(4), were incapable of inhibiting USF DNA binding even at
doses of 10 molar equivalents (Fig. 1). Natural USF1 dimers, at 4 µM
in a buffer containing 12.5 mM phosphate (pH 7.4) and 150 mM KCl, have
a melting temperature (Tm) of 41.7°C and a
calculated stability of
9.3 kcal mol
1, while the
heterodimers with A-USF display a Tm of 57.8°C
and a stability of
13.9 kcal mol
1 (data not shown).

View larger version (25K):
[in this window]
[in a new window]
|
FIG. 1.
Inhibition of USF DNA binding by A-USF. The effect of
different bHLH-zip dominant-negative mutants on USF DNA-binding
activity was examined by EMSA. Binding reactions were performed under
physiological conditions (12.5 mM phosphate [pH 7.4] and 150 mM KC1),
and the reaction mixtures contained 10 11 M probe (17-bp
double-stranded oligonucleotide containing a USF-specific binding site)
alone (lane 1) or combined with 10 8 M recombinant USF1
(bHLH-zip domain) (lanes 2 to 8). When indicated, USF binding was
challenged by the addition of the following dominant-negative mutants:
A-USF at 1 × 10 8 or 3 × 10 8 M
(lanes 3 and 4), A-Mitf at 1 × 10 8 or 1 × 10 7 M (lanes 5 and 6), or A-Max also at 1 × 10 8 or 1 × 10 7 M (lanes 7 and 8).
|
|
EMSA.
Mini-nuclear extracts from HeLa and Saos-2 cells were
prepared in accordance with the procedure of Schreiber et al.
(32). Standard DNA-binding reactions contained either 3 µg
of protein from mini-nuclear extract or 1.5 µl of whole-cell extract
prepared as for the luciferase assay, 1 µg of poly(dI-dC), and
0.1 ng of radiolabeled probe in 10-µl mixtures composed of 10 mM
Tris-HCl (pH 7.9), 60 mM NaCl or KCl, 1 mM dithiothreitol, and 0.1%
Triton X-100. Probes used for EMSA included a 150-bp DNA fragment or a
30- or 33-bp oligonucleotide, as indicated in the figure legends. When
specified, the DNA-binding reaction mixtures also contained as a
competitor DNA 10 ng of a 30-bp oligonucleotide containing or lacking
the USF consensus binding site. After a 20-min incubation at 30°C,
the reaction mixtures were supplemented with 2 µl of a 15% Ficoll
solution and analyzed by electrophoresis on 4% acrylamide-0.2% bisacrylamide-22 mM Tris-borate (pH 8.3)-0.5 mM EDTA gels.
Antibodies and indirect immunostaining.
USF1- and
USF2-specific rabbit polyclonal antibodies (35) were used
for supershift analysis and immunostaining. USF polypeptide antibodies
(Santa Cruz Biotechnology) were used for Western blot analysis. All
procedures for immunostaining were carried out at room temperature.
Transfected Saos-2 cells grown on coverslips were fixed in 4%
formaldehyde for 15 min, washed three times with phosphate-buffered
saline (PBS), permeabilized with 0.15% Triton X-100 in PBS, and washed
three more times with PBS. After they were blocked with 1% bovine
serum albumin (BSA) in PBS for 30 min, the cells were treated for
1 h with the primary antibodies diluted 1:200 in PBS containing
0.1% BSA, washed three times with PBS, and finally stained with
fluorescein isothiocyanate-conjugated goat anti-rabbit immunoglobulin G
(Cappel, West Chester, Pa.) diluted 1:1,000 in PBS containing 0.1%
BSA. After counterstaining with propidium iodide, the coverslips were
mounted on microscope slides by using 50% glycerol. Samples were
examined and scanned at ×400 magnification with a Zeiss confocal laser
scanning microscope. Composite images were assembled by using Adobe
Photoshop and Canvas softwares.
 |
RESULTS |
USF is inactive in Saos-2 cells.
The growth inhibitory
activity of the transcription factor USF in HeLa cells was demonstrated
by a colony formation assay after cotransfection with a neomycin
resistance gene (22). Overexpression of USF1 reduced by
about 50% the number of neomycin-resistant colonies, while
overexpression of USF2 essentially abolished colony formation. In
contrast, USF1 or USF2 overexpression had essentially no effect on the
colony-plating ability of Saos-2 cells (Fig. 2A).

View larger version (19K):
[in this window]
[in a new window]
|
FIG. 2.
USF1 and USF2 are both inactive in Saos-2 cells. (A)
Colony formation assay. Plates of HeLa or Saos-2 cells were transfected
with 2 µg of pSV2neo and 6 Eg of either psvUSF1, psvUSF2, or the
pSG5 empty expression vector, as indicated. After G418 selection,
colonies were stained with crystal violet and counted. The results
shown are the average and standard deviation for colony numbers
determined in three independent experiments. (B) Transient-transection
assay. Plates of either HeLa or Saos-2 cells were transfected with 10 µg of the pU3MLLuc reporter plasmid and 9 µg of either pSG5,
psvUSF1, or psvUSF2. Luciferase activities were determined 40 h
after transfection. The results, expressed as fold activation, were
averaged from a minimum of five independent experiments.
|
|
Since growth inhibition in HeLa cells requires the transcriptional
activation domain of USF (
22), this initial observation
prompted us to examine the transcriptional activity of USF in
Saos-2
cells. For this, we used the pU3MLLuc reporter, in which
transcription
of a luciferase gene is controlled by three USF
binding sites upstream
of the adenovirus major late minimum promoter
(
23). In
Saos-2 cells, cotransfection of either USF1 or USF2
with the pU3MLLuc
reporter did not enhance luciferase activity
over the basal level
obtained in the absence of exogenous USF.
Yet, under the same
conditions, transcription from the pU3MLLuc
reporter in HeLa cells was
stimulated about 60-fold by USF1 and
20-fold by USF2 (Fig.
2B). Taken
together, these results suggest
that exogenous USF was completely
inactive in Saos-2
cells.
Expression, subcellular localization, and DNA-binding activity of
USF in Saos-2 cells.
We next investigated whether there were
differences in the expression, subcellular localization, or DNA-binding
activity of USF that could account for the differences observed between
Saos-2 cells and HeLa cells. As shown in Fig.
3A, Western blot analysis of endogenous
USF in nuclear extracts from HeLa and Saos-2 cells prepared under
identical conditions revealed comparable USF1 and USF2 polypeptide
levels in both cell lines. EMSA analysis also demonstrated similar USF
DNA-binding activities in the two cell lines (Fig. 3B). A supershift
assay using rabbit polyclonal antibodies specific to either USF1 or
USF2 (Fig. 3C) indicated that the major USF species in Saos-2 cells
were the USF1-USF2 heterodimers; USF1 homodimers were less abundant,
and USF2 homodimers were almost completely absent (Fig. 3D). This
distribution is identical to that previously characterized in many
other cell types, including HeLa (30, 35, 39, 36).

View larger version (22K):
[in this window]
[in a new window]
|
FIG. 3.
Expression of USF in Saos-2 cells. (A and B) Nuclear
extracts from HeLa and Saos-2 cells prepared under identical conditions
were used to compare the endogenous levels of USF1 and USF2 present in
both cell lines by Western blot analysis (A) and EMSA (B). (C) Control
for the specificity of the USF-specific antibodies in supershift
analysis. DNA binding reaction mixtures were assembled with nuclear
extracts from HeLa cells transiently transfected with either USF1,
USF2, or both, as indicated. Prior to electrophoresis, the protein-DNA
complexes were incubated with polyclonal antibodies specific to USF1
( -U1) or USF2 ( -U2), as indicated above each lane. (D) Antibody
supershift analysis of endogenous USF in Saos-2 nuclear extracts.
Migration of the major USF dimers is indicated.
|
|
To examine the subcellular localization of USF in Saos-2 cells,
transiently transfected cells were stained with USF1- or USF2-specific
antibodies and fluorescein-conjugated secondary antibodies and
then
counterstained with propidium iodide and visualized by confocal
microscopy. As illustrated in Fig.
4,
staining of both USF1 and
USF2 localized predominantly in the nuclei
with nucleoli exclusion.
In contrast, cells transfected with
U2

B

USR, a USF2 mutant lacking
both known nuclear localization
signals (
23), showed predominantly
cytoplasmic staining.
These experiments indicated that the loss
of USF activity in Saos-2
cells was not related to an altered
subcellular localization and that,
at least for USF2, the same
protein domains were required for nuclear
localization in Saos-2
as in HeLa cells.

View larger version (46K):
[in this window]
[in a new window]
|
FIG. 4.
Subcellular localization of USF in Saos-2 cells. Cells
were transfected with either USF2 (a to c), USF1 (d to f), or the
U2 B USR mutant (23) that lacks both of the USF2 nuclear
localization signals (g to i). The transiently transfected cells were
stained with USF1- or USF2-specific antibodies and fluorescein
isothiocyanate-conjugated secondary antibodies (green) and
counterstained with propidium iodide (red). Shown are confocal
microscopy images that demonstrate the colocalization of the wild-type
USF1 or USF2 proteins with DNA in the nuclei (c and f), while the
nuclear localization mutant remained in the cytoplasm (i).
|
|
The overexpression levels and integrities of exogenous USF1 and USF2
proteins produced by transient transfection with different
amounts of
expression vectors in HeLa and Saos-2 cells were examined
by Western
blotting (Fig.
5A) and EMSA (Fig.
5B) and
found to
be similar. These titration experiments also served to rule
out
the possibility that the inactivity of USF in Saos-2 cells could
be
due to a particularly strong self-squelching effect. When expressed
at
very high levels, many transcriptional activators squelch activated
transcription (
28). This squelching phenomenon is thought to
be due to the sequestration in solution of transcriptional components,
preventing their interaction at gene promoters. However, decreasing
the
concentration of overexpressed USF1 or USF2 in Saos-2 cells
had no
effect on the activity of the cotransfected reporter, while
in HeLa
cells reporter activity decreased with decreasing USF
concentrations
(Fig.
5C). These results were inconsistent with
a strong squelching
phenomenon causing the inactivity of USF in
Saos-2 cells.

View larger version (52K):
[in this window]
[in a new window]
|
FIG. 5.
Expression of exogenous USF in HeLa and Saos-2 cells. (A
to C) Cells were transiently transfected by using the pU3MLLuc reporter
and various amounts of the USF1 or USF2 expression vector. The same
extracts were used to examine the expression level and integrity of the
overexpressed USF proteins by Western blot analysis (A) and EMSA (B)
and to quantitate transcriptional activities by the luciferase assay
(C). EMSA analysis was carried out with a radiolabeled 30-bp
oligonucleotide containing the USF consensus binding site. Unlabelled
competitor oligonucleotide (Comp.) was added as indicated. (D) Control
for the overexpression of USF in stably transfected Saos-2 cells.
G418-resistant Saos-2 colonies transfected with pSV2neo and the
indicated USF expression vector, as described for Fig. 2, were
individually expanded and processed for mini-nuclear extract
preparation. EMSA was carried out with a radiolabeled 33-bp
oligonucleotide containing the adenovirus major late USF binding site.
The migration of complexes containing exogenous USF1 and USF2
homodimers is indicated.
|
|
We also verified that the lack of growth inhibition by USF in Saos-2
cells observed in the colony formation assay was not
due to a lack of
expression in the stable transfection assay.
Several G418-resistant
colonies from Saos-2 plates transfected
with pSV2neo and either USF1 or
USF2 were individually expanded,
and nuclear extracts were prepared. In
different colonies, EMSA
revealed weak to very strong overexpression of
the transfected
USF gene in comparison to the endogenous levels
observed in colonies
transfected with the empty vector (Fig.
5D). Thus,
the inability
of USF to affect the colony-plating ability of Saos-2
cells was
not due to a lack of expression in stably transfected cells.
Instead,
it probably reflected the inability of the USF proteins to
activate
transcription in this particular cell
line.
Saos-2 USF can mediate transcriptional activation by the
varicella-zoster virus IE62 protein.
Although endogenous and
ectopically expressed USF extracted from Saos-2 cells bound DNA in
vitro (Fig. 3B and 5B), none of the experiments described above could
rule out the possibility that DNA binding by USF was prevented in vivo,
for instance, by some labile posttranslational modification or by
interaction with a repressor. To examine the DNA-binding ability of
Saos-2 USF in vivo, we took advantage of the known interaction between
USF and the viral IE62 protein. In HeLa and other cell lines, IE62 is a
very strong transcriptional activator at promoters containing a single
USF binding site. This activation by IE62 utilizes either endogenous
USF or ectopic USF1 or USF2 and can be inhibited by cotransfection of a
USF dominant-negative mutant (24). Cooperation with IE62
requires the DNA-binding domain of USF as well as other USF domains
involved in transcriptional activation (24).
To determine whether IE62 could activate transcription in Saos-2 cells
in cooperation with endogenous USF, cells were transfected
with either
the LCJM-1 reporter plasmid that contains the varicella-zoster
virus
DNA polymerase gene promoter driving luciferase or the related
LCJM-10
plasmid in which a 3-bp mutation has been introduced in
the USF binding
site (
24) (Fig.
6A). IE62
activated transcription
from the LCJM-1 reporter in Saos-2 cells nearly
40-fold over the
basal level, while mutation of the USF site in the
LCJM-10 reporter
essentially abolished IE62 transactivation (Fig.
6B).
This result
demonstrated that Saos-2 cells contained proteins that
interacted
with the USF binding site in plasmid LCJM-1 and mediated
activation
by IE62 through that site. To verify that these endogenous
proteins
were USF itself, we used USF dominant-negative mutants.
Cotransfection
of mutant USF2

B, which lacks the basic region of
USF2, reduced
transcriptional activation by IE62 in Saos-2 cells to
50% of the
activity observed with IE62 alone (Fig.
6C). It is
important to
note that under the same conditions, inhibition by
USF2

B in HeLa
cells was usually more pronounced, reducing activation
by IE62
to less than 20% of the control (
24). However, this
quantitative
difference may simply reflect the lesser transfection
efficiency
for Saos-2 cells in comparison to that for HeLa cells. We
therefore
turned to a more potent dominant-negative mutant of USF,
A-USF.
In this construct, the basic region of the bHLH-zip domain of
USF1 was replaced with an acidic sequence (EEEDDEEELEELE),
which
greatly stabilizes the heterodimers between A-USF and
USF (
18,
19,
26). Consequently, A-USF is a very efficient
inhibitor
of USF DNA binding (Fig.
1). Cotransfection of A-USF reduced
transactivation
by IE62 in Saos-2 cells to about 20% of the control
value, demonstrating
that endogenous USF was indeed an essential
cooperating partner
for activation by IE62 in Saos-2 cells, just as in
HeLa cells.
Transcriptional activation by IE62 in the presence of A-USF
was
restored by cotransfecting either USF1 or USF2, indicating that,
as
also true in HeLa cells, IE62 could cooperate with either of
these
transcription factors to activate transcription through
USF sites in
Saos-2 cells (Fig.
6C). These experiments demonstrate
that both
endogenous and ectopically expressed USF proteins were
active in
specific DNA binding in Saos-2 cells.

View larger version (23K):
[in this window]
[in a new window]
|
FIG. 6.
Transcriptional activation by IE62 in Saos-2 cells. (A)
Schematic representation of the reporter constructs. LCJM-1 contains
the varicella-zoster virus DNA polymerase promoter that drives
transcription of a luciferase reporter gene. LCJM-10 is identical to
LCJM-1 except for the indicated 3-bp substitution in the USF binding
site. (B) Saos-2 cells were transfected with 10 µg of the indicated
reporter plasmid and 0.4 µg of either the IE62 expression vector
pCMV62 or the corresponding empty vector. Luciferase activities were
determined 45 h after transfection. (C) Effect of USF
dominant-negative mutants on IE62 activity in Saos-2 cells.
Cotransfected plasmids included 10 µg of LCJM-1, 0.4 µg of pCMV62,
and 5 µg each of the indicated USF expression vectors. The results of
the luciferase assay were normalized relative to the activity obtained
with IE62 alone. (D) Domains of USF required for cooperation with IE62
in Saos-2 cells. Cotransfected plasmids included 10 µg of LCJM-1, 0.4 µg of pCMV62, and 5 µg of the indicated expression vectors. The
results of the luciferase assay were normalized relative to the
activity obtained with IE62 alone.
|
|
The domains of USF required for interaction with IE62 in Saos-2 cells
were investigated by examining the effect of cotransfecting
different
USF constructs. Cotransfection of either USF1 or USF2
did not
significantly alter LCJM-1 transcription from the level
observed with
IE62 alone, indicating that endogenous USF levels
were already
sufficient to support full activation. Cotransfection
of U2

N, a
mutant containing the bHLH-zip domain of USF2 but lacking
all
N-terminal sequences, strongly inhibited IE62 activity (Fig.
6D). This
demonstrated that other domains of USF2, besides those
necessary for
dimerization and DNA binding, were required for
IE62 interaction. One
of these IE62-interacting domains was located
within the USR, since
mutant U2

(7-186), which contains only the
USR and bHLH-zip domains
of USF2, was nearly as efficient at supporting
IE62 activation as the
full-length USF proteins (Fig.
6D). Since
the USR is one of the most
conserved USF domains, this result
was consistent with the ability of
IE62 to cooperate equally well
with USF1 and
USF2.
Activity of USF-VP16 fusion proteins in Saos-2 cells.
To
determine whether exogenous USF could not only bind DNA in Saos-2 cells
but also assemble into functional transcription complexes, we
investigated the activity of different fusion proteins containing the
DNA-binding domain of USF2 and the VP16 transcriptional activation
domain. As shown in Fig. 7B, a hybrid
protein containing the VP16 activation domain fused downstream of the
leucine zipper of USF2 (12) was expressed at similar levels
in HeLa and Saos-2 cells. In HeLa cells, USF2-VP16 efficiently
activated transcription of the pU3MLLuc reporter gene when present at
low concentrations. Greater expression levels, however, were
inhibitory, presumably as a result of self-squelching (28).
Interestingly, activation of pU3MLLuc transcription by USF2-VP16 in
Saos-2 cells closely resembled that observed in HeLa cells, with a
similar amplitude and a similar squelching at elevated concentrations
(Fig. 7A). Identical results were obtained for fusion constructs
containing the VP16 activation domain inserted either at the N-terminus
or in the middle of USF2 (data not shown). Taken together, these experiments demonstrated that the transcriptional deficiency of Saos-2
cells was not a general phenomenon, since transactivators such as IE62
and USF2-VP16 were active in this cell line. Also, the DNA-binding
domain of USF was clearly functional in Saos-2 cells, since activation
by USF2-VP16 required the presence of USF binding sites in the reporter
gene (data not shown). Thus, the inactivity of the wild-type USF
proteins in Saos-2 cells was not caused by their inability to interact
with the promoter DNA but by their inability to subsequently activate
transcription.

View larger version (26K):
[in this window]
[in a new window]
|
FIG. 7.
Transactivation by USF2-VP16 in HeLa and Saos-2 cells.
HeLa or Saos-2 cells were transfected with 10 µg of the pU3MLLuc
reporter plasmid and variable amounts of the USF2-VP16 expression
vector, as indicated. (A) Transcriptional activity. The results of the
luciferase assay were averaged from two independent experiments and are
expressed as fold activation over the basal level in the absence of
USF2-VP16. (B) Levels of USF2-VP16 expression. The DNA-binding activity
of USF2-VP16 was monitored by EMSA using a radiolabelled 33-bp
oligonucleotide containing the USF consensus binding site. The
migration of complexes containing endogenous USF or the USF2-VP16
protein is indicated.
|
|
The USR is responsible for the inactivity of USF2 in Saos-2 cells
on initiator-containing reporters.
A series of deletion mutants
and hybrid proteins was used to investigate the domains responsible for
the inactivity of USF2 in Saos-2 cells. In the case of reporter genes
containing an initiator element, previous studies had demonstrated that
the USR of USF1 and USF2 functioned as an autonomous, specialized
activation domain (23). In agreement with these earlier
results, a construct containing only the USR and DNA-binding domains of
USF2 (U2
7-186) was found to strongly activate the pU3MLLuc reporter
in HeLa cells, while a USF2 mutant lacking only the USR (U2
USR) was
inactive (Fig. 8A). Like wild-type USF2,
U2
7-186 was completely inactive in Saos-2 cells (Fig. 8B). This
result narrowed down the possible domains responsible for USF2 loss of
function in Saos-2 cells to either the USR or the C-terminal
dimerization and DNA-binding domain. To discriminate between these last
two possibilities, a domain swapping experiment was performed with the
related bHLH-zip transcription factor TFE3 (1).
Overexpression of wild-type TFE3 activated transcription from the
pU3MLLuc reporter to similar levels in HeLa and Saos-2 cells,
confirming that the transcriptional defect of Saos-2 cells was specific
to USF (Fig. 8B). A hybrid protein composed of the N-terminal domain of
USF2 and the DNA-binding domain of TFE3 displayed strong activity in
HeLa cells (Fig. 8B), even though its expression level was lower than
that of wild-type USF2 (Fig. 8C). In contrast, the same USF2-TFE3
fusion protein was completely inactive in Saos-2 cells (Fig. 8B). This
result demonstrated that the DNA-binding domain of USF2 was dispensable for cell type specificity and that inactivity in Saos-2 cells was
instead associated with the USR-containing N-terminal region.

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 8.
The USR activation domain is responsible for the
inactivity of USF2 in Saos-2 cells. Cotransfection experiments were
carried out in HeLa and Saos-2 cells by using the pU3MLLuc reporter (10 µg) and different USF2 (5 µg) or TFE3 (15 µg) expression vectors.
Reporter gene activity was determined 40 to 42 h after
transfection. (A) Schematic representation of the USF constructs. (B)
The results of the luciferase assays, expressed as fold activation over
the levels determined in the presence of the corresponding empty
vector, were averaged in each case from a minimum of three independent
experiments. (C) Expression of USF2 and USF2-TFE3 constructs in HeLa
and Saos-2 cells was compared in one set of extracts by Western blot
analysis using peptide antibodies specific to either the N or C
terminus of USF2. The asterisk indicates the migration of a
USF-unrelated cross-reacting protein.
|
|
Taken together, the results of this mutational analysis strongly
suggest that the inactivity of USF2 on the pU3MLLuc reporter
in Saos-2
cells resulted from the inability of the USR to function
as an
initiator-dependent activation domain. Since the USR is
highly
conserved between USF1 and USF2, loss of USR function in
Saos-2 cells
accounted for the inactivity of both USF1 and
USF2.
USF1 and USF2 contain activation domains that are active in Saos-2
cells.
The USR is a specialized, initiator-dependent activation
domain that does not function in the context of Gal4 fusion proteins (23). However, additional activation domains have also been identified in both USF1 and USF2 that can, at least in HeLa cells, function as Gal4 fusions (13, 15, 23). To investigate the activity of these more classical USF domains in Saos-2 cells, we
carried out cotransfections experiments with the pG5E1bCAT reporter
(Fig. 9A) and various Gal4 fusion
proteins. As illustrated in Fig. 9B, control transfections with
Gal4-VP16 revealed similar activities of this potent transactivator on
the pG5E1bCAT reporter in both HeLa and Saos-2 cells. Interestingly,
significant transcriptional activity was also detected in both cell
lines for Gal4-USF2 and Gal4-USF1 hybrid proteins. This result
demonstrated that the coactivators required for the classical
activation domains of USF1 and USF2 were present in Saos-2 cells.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 9.
Context-dependent activity of the classical activation
domains of USF1 and USF2 in HeLa and Saos-2 cells. (A) Schematic
representation of the reporter plasmids. (B) Activity of Ga14-USF
fusions in HeLa and Saos-2 cells. Cotransfections were carried out with
10 µg of pG5E1bCAT and 5 µg of the indicated Ga14 expression
vectors. Transcriptional activities were determined by CAT assay. An
autoradiogram from a representative experiment is shown, with
quantitation indicated below each lane as the ratio of CAT activity
observed in each case to the basal level observed with Ga14(1-147)
alone. (C) Transactivation of the pU2E1bCAT reporter in HeLa and Saos-2
cells. Cotransfections were carried out with pU2E1bCAT (10 µg) and
expression vectors for USF1 (9 µg), USF2 (9 µg), USF2-VP16 (0.32 µg), or IE62 (0.5 µg), as indicated, and analyzed by the CAT assay
as described for panel B.
|
|
The existence of USF activation domains that were functional in Saos-2
cells suggested that the USF inactivity could be promoter
dependent. To
explore this possibility, we next compared the activities
of USF1 and
USF2 in HeLa and Saos-2 cells by using a reporter
gene containing the
same E1b core promoter present in the reporter
used with the Gal4-USF
fusion proteins (pU2E1bCAT) (Fig.
9A).
Control transfections
demonstrated that this reporter was strongly
activated by USF2-VP16 as
well as by IE62 in both HeLa and Saos-2
cells. In contrast, the natural
USF1 and USF2 proteins again demonstrated
transcriptional activity in
HeLa cells exclusively and not in
Saos-2 cells (Fig.
9C). Since the
activity of the Gal4-USF fusions
indicated a similar availability of
coactivators in both cell
lines, this observation suggested that the
activity of the classical
activation domains of USF1 and USF2 in their
natural context was
somehow inhibited in Saos-2
cells.
Essential role of the USR in transcriptional activation by USF in
the absence of an initiator element.
Earlier studies in HeLa cells
had mapped the USF2 exon 5-encoded region as the activation domain
essential both for activation by Gal4-USF2 and for activation of
pU2E1bCAT by wild-type USF2 (23). Yet, the inability of USF2
to activate pU2E1bCAT in Saos-2 cells suggested additional requirements
besides the presence of this exon 5 domain. These requirements were
investigated by testing additional mutants (Fig.
10). In HeLa cells, an N-terminal
deletion mutant of USF2 containing only the exon 5, USR, and
DNA-binding domains [construct U2
(7-148)] (Fig. 10) was even more
active than the wild-type protein in stimulating transcription of the
pU2E1bCAT reporter. However, further deletion of the exon 5 region, as
in construct U2
(7-186), abolished activity. A USF2 mutant lacking only the exon 5 region (construct U2
E5) proved also completely inactive. These results confirmed the importance of the exon 5 activation domain for transactivation of E1b-driven reporters. Furthermore, since the U2
(7-186) and the U2
E5 mutants both
contained an intact USR domain and were fully active with the pU3MLLuc
reporter (reference 23 and data not shown), this
analysis also confirmed the specificity of the USR activation domain
for promoters that contained an initiator element.

View larger version (13K):
[in this window]
[in a new window]
|
FIG. 10.
In its natural context, the classical activation domain
of USF2 is controlled by the USR. Cotransfections were carried out in
HeLa and Saos-2 cells by using the pU2E1bCAT reporter and the various
USF mutants depicted on the left of the figure. The results, expressed
as fold activation, were calculated from a minimum of three independent
experiments. E5, exon 5-encoded activation domain (hatched boxes).
|
|
Interestingly, a small deletion removing only the USR abolished the
activity of USF2 in HeLa cells on the pU2E1bCAT reporter
despite the
presence of an intact exon 5 domain (mutant U2

USR)
(Fig.
10). This
result demonstrated that, within its normal context,
activity of the
exon 5 activation domain required the presence
of the USR. Since the
USR domain was found to be inactive in Saos-2
cells, its absolute
requirement for activity of the exon 5 domain
also explained the
inactivity of USF2 in Saos-2 cells with the
pU2E1bCAT
reporter.
In wild-type USF2, the exon 5 and USR domains are normally adjacent. It
was therefore important to establish whether this
positioning played a
role in the USR requirement for activity
of the exon 5 domain. For
this, we constructed a mutant in which
an additional exon 5 domain was
inserted at the N terminus of
USF2, in a position expected to be out of
the control of the USR.
The resulting construct, E5-USF2, was found
functional in Saos-2
cells, where its activity was similar to that of
natural USF2
in HeLa cells (Fig.
10). This result confirmed the
intrinsic activity
of the exon 5 domain in Saos-2 cells. It also
suggested that,
in wild-type USF2, one of the USR functions is to
trigger a conformational
change that exposes the adjacent exon 5 activation domain. As
expected, E5-USF2, with two active exon 5 domains, displayed in
HeLa cells a greatly enhanced activity as
compared to that of
wild-type USF2 (Fig.
10).
 |
DISCUSSION |
The results presented in this report indicate a loss of USF
function in the Saos-2 cell line. In HeLa cells, the USF proteins function as transcriptional effectors and, when overexpressed, inhibit
proliferation. These two activities of USF are in all likelihood
related. Indeed, effective growth inhibition by USF2 requires all
functional domains of the protein, including those directly implicated
in transcriptional activation (22, 22a). Therefore, it seems
likely that the inability of USF to inhibit the growth of Saos-2 cells
is a direct consequence of its transcriptional inactivity.
Several possible explanations for the absence of USF activity in Saos-2
cells were ruled out by our analysis. For instance, we showed that the
USF proteins properly localize in the nucleus of Saos-2 cells (Fig. 4),
where they are furthermore fully active in DNA binding (Fig. 3 and 5).
This latter property is also demonstrated by the ability of both
endogenous and exogenous USF to mediate transcriptional activation by
IE62 in a USF binding site-dependent fashion (Fig. 6). It is further
illustrated by the activity in Saos-2 cells of the USF2-VP16 fusion
protein, which necessitates its specific interaction with the promoter
DNA. The inactivity of both USF1 and USF2 in Saos-2 cells on all
promoters tested is not due to a deficiency of general transcription
factors and/or coactivators in this cell line since several other
transcription factors were as active in Saos-2 cells as in HeLa cells.
Activation domains that functioned similarly in both HeLa and Saos-2
cells included those of VP16, TFE3, and IE62, as well as the classical activation domains of USF1 and USF2. The transcriptional defect of
Saos-2 cells is therefore not of a general nature but is instead specific to USF.
Given that, in Saos-2 cells, USF is capable of specific interaction
with its cognate binding sites in gene promoters and contains at least
one functional activation domain, its complete inactivity on all
reporters tested indicates that this activation domain must be masked.
Two different models can be considered to account for these
observations. First, a corepressor, present in Saos-2 but not HeLa
cells, could interact with promoter-bound USF and interfere with the
function of its activation domain. Alternatively, a specific
coactivator necessary for USF activity could be either absent or
inactivated in Saos-2 cells. Although our results cannot formally
exclude the repressor model, several observations seem inconsistent
with this idea. First, one would expect that the large amounts of
exogenous USF produced in transient-transfection assays would
eventually titrate out the putative repressor and unmask the activity.
Second, one would imagine that the interaction of a repressor with
DNA-bound USF would also prevent activation by at least some of the USF
fusion proteins. Yet, in all cases tested, insertion of an additional
activation domain (e.g., that of VP16) at different locations within
USF2 restored transcriptional activity in Saos-2 cells. It seems
therefore more likely that the transcriptional activity of USF1 and
USF2 is controlled by interaction of a specialized coactivator that
recognizes the conserved USR domain and is somehow inactivated in
Saos-2 cells.
As depicted schematically in Fig. 11,
the specific coactivator model is also entirely consistent with the
importance of different domains for transcriptional activation of
different reporter genes by USF2. In the presence of an initiator
element, the USR was found both necessary and sufficient for USF2
activity in HeLa cells. This result is perfectly understandable if the
cofactor mediates the stimulatory effect of USF by interacting with or perhaps recruiting initiator-binding proteins. In the absence of an
initiator element, cofactor binding may trigger a conformational change
in USF that exposes the classical activation domain. This would explain
the dual requirement in this case for both the USR and the USF2 exon 5 activation domains. Finally, the USR-dependent coactivator model is
also consistent with the context-independent activity of the USF-VP16
and Gal4-USF fusion proteins (Fig. 11).

View larger version (20K):
[in this window]
[in a new window]
|
FIG. 11.
Specific coactivator model for the cell-type-dependent
activity of transcription factor USF. USF and related proteins are
schematically represented with classical activation domains indicated
by black ovals and the USR indicated by hatched ovals. In HeLa cells,
association of a specific cofactor (crescent) interacting with the USR
domain mediates the transcriptional activation by USF of
initiator-containing promoters. In the case of promoters lacking an
initiator, binding of the cofactor triggers a conformational change
that exposes the other activation domain of USF. In Saos-2 cells, the
absence of the cofactor, or its inability to recognize the USR due to
altered posttranslational modification, is responsible for the complete
inactivity of native USF proteins. Interaction of IE62 (oval) bypasses
the requirement for the cellular coactivator. This model also explains
the activity in Saos-2 cells of mutants such as USF2-VP16 and E5-USF2
in which the additional activation domains are independent of proper
USR function.
|
|
Is the coactivator simply missing in Saos-2 cells? While this is
certainly the simplest and perhaps most likely possibility, it is also
conceivable that posttranslational modifications could either permit or
prevent the USF-cofactor interaction. In that case, HeLa and Saos-2
cells would differ in the expression of the cognate modifying enzymes.
Finally, it is important to note that the repressor and cofactor models
of USF function are not necessarily exclusive. USF activity may well be
controlled in different cells by both mechanisms. A similar regulation
by both corepressors and coactivators is well documented in the case of the hormone receptors (33). Whatever the mechanism involved in the cell type-dependent activity of USF, the observations reported here strongly suggest the existence of at least one cellular factor that can simultaneously affect the activity of all USF proteins. This
cellular cofactor could be very similar to the viral IE62 protein,
which functions equally well with USF1 or USF2 and also recognizes the
USR (Fig. 6D).
The inactivity of USF is not unique to Saos-2 cells. Preliminary
studies in several cell lines suggested that a loss of USF function is
not uncommon in transformed cells, especially among those derived from
breast tumors (10a). These observations may have profound
implications for the mechanisms of cancer progression. Indeed, our
studies of embryonic fibroblasts suggested that the activity of USF
could be essential in protecting cells against the tumorigenic
potential of Myc (22). Myc overexpression, whether due to
gene amplification, translocation, or increased message stability, is a
common event in tumor progression that favors rapid proliferation
(16). In other contexts, events leading to USF inactivation
may well promote uncontrolled growth just like Myc deregulation does.
While simultaneous inactivation of all alleles of the USF1
and USF2 genes is obviously unlikely to occur, the results
described here strongly suggest the existence of a cofactor or
modifying enzyme that is absolutely required for USF function. Thus, a
complete loss of USF function could be brought about by the
inactivation of a single gene, and such an event could play an
essential role in tumorigenesis. The fact that Saos-2 cells are known
to be deficient in both p53 and Rb activities (5, 34) raises
the intriguing possibility that the inactivity of USF may come as a
consequence of the loss of one of these two tumor suppressors. However,
preliminary experiments indicated that neither p53 nor Rb
overexpression could restore USF activity in Saos-2 cells, as
determined by a transient-cotransfection assay (data not shown). Those
results seem to rule out a direct involvement of either p53 or Rb in
the cell-type-dependent activity of USF.
 |
ACKNOWLEDGMENTS |
We are grateful to Howard C. Towle for the USF2-VP16 construct,
to Kuo Ooi for assisting in plasmid construction, and to Marilyn N. Szentirmay and Michael W. Dyke for critical reading of the manuscript.
This work was supported by grants G-1195 from the Robert A. Welch
foundation, DMAD17-96-1-6221 from the Department of the Army, and
CA79578 from the National Institutes of Health. Additional support was
provided by institutional funds and by a postdoctoral fellowship from
National Cancer Institute Training Grant CA09299 (T.L.). The confocal
microscopy facility at the M.D. Anderson Cancer Center is supported by
grant CA16672.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Department of
Molecular Genetics, The University of Texas M. D. Anderson Cancer
Center, 1515 Holcombe Blvd., Houston, TX 77030. Phone: (713) 794-1281. Fax: (713) 794-4295. E-mail:
msawadog{at}notes.mdacc.tmc.edu.
Present address: Department of Biochemistry, University of Texas
Southwestern Medical Center, Dallas, TX 75235.
 |
REFERENCES |
| 1.
|
Beckmann, H.,
L.-K. Su, and T. Kadesch.
1990.
TFE3: a helix-loop-helix protein that activates transcription through the immunoglobulin enhancer µE3 motif.
Genes Dev.
4:167-179[Abstract/Free Full Text].
|
| 2.
|
Bendall, A. S., and P. L. Molloy.
1994.
Base preference for DNA binding by the bHLH-Zip protein USF: effects of MgCl2 on specificity and comparison with binding of Myc family members.
Nucleic Acids Res.
22:2801-2810[Abstract/Free Full Text].
|
| 3.
|
Blackwell, T. K.,
L. Kretzner,
E. M. Blackwood,
R. N. Eisenman, and H. Weintraub.
1990.
Sequence-specific DNA binding by the c-Myc protein.
Science
250:1149-1151[Abstract/Free Full Text].
|
| 4.
|
Blackwood, E. M., and R. N. Eisenman.
1991.
Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc.
Science
251:1211-1217[Abstract/Free Full Text].
|
| 5.
|
Chandar, N.,
B. Billing,
J. McMaster, and J. Novak.
1992.
Inactivation of p53 gene in human and murine osteosarcoma cells.
Br. J. Cancer
65:208-214[Medline].
|
| 6.
|
Cogswell, J. P.,
M. M. Godlevski,
M. Bonham,
J. Bisis, and L. Babiss.
1995.
Upstream stimulatory factor regulates expression of the cell cycle-dependent cyclin B1 gene promoter.
Mol. Cell. Biol.
15:2782-2790[Abstract].
|
| 7.
|
Fisher, D. E.,
C. S. Carr,
L. A. Parent, and P. A. Sharp.
1991.
TFEB has DNA-binding and oligomerization properties of a unique helix-loop-helix/leucine-zipper family.
Genes Dev.
5:2342-2352[Abstract/Free Full Text].
|
| 8.
|
Gregor, P. D.,
M. Sawadogo, and R. G. Roeder.
1990.
The adenovirus major late transcription factor USF is a member of the helix-loop-helix group of regulatory proteins and binds to DNA as a dimer.
Genes Dev.
4:1730-1740[Abstract/Free Full Text].
|
| 9.
|
Hemesath, T. T.,
E. Steingrimsson,
G. McGill,
M. J. Hansen,
J. Vaught,
C. A. Hodgkinson,
H. Arnheiter,
N. G. Copeland,
N. A. Jenkins, and D. E. Fisher.
1994.
microphthalmia, a critical factor in melanocyte development, defines a discrete transcription factor family.
Genes Dev.
8:2770-2780[Abstract/Free Full Text].
|
| 10.
|
Henrion, A. A.,
S. Vaulont,
M. Raymondjean, and A. Kahn.
1996.
Mouse USF1 gene cloning: comparative organization with the c-myc gene family.
Mamm. Genome
7:803-809[Medline].
|
| 10a.
| Ismail, P. M., and T. Lu. Unpublished observations.
|
| 11.
|
Kaulen, H.,
P. Pognonec,
P. D. Gregor, and R. G. Roeder.
1991.
The Xenopus B1 factor is closely related to the mammalian activator USF and is implicated in the developmental regulation of TFIIIA gene expression.
Mol. Cel. Biol.
11:412-424[Abstract/Free Full Text].
|
| 12.
|
Kayto, E. N.,
H. M. Shih, and H. C. Towle.
1997.
Carbohydrate regulation of hepatic gene expression evidence against a role for the upstream stimulatory factor.
J. Biol. Chem.
272:7525-7531[Abstract/Free Full Text].
|
| 13.
|
Keegan, L.,
G. Gill, and M. Ptashne.
1986.
Separation of DNA binding from the transcription-activating function of an eukaryotic regulatory protein.
Science
231:699-704[Abstract/Free Full Text].
|
| 14.
|
Kerkhoff, E.,
K. Bister, and K. H. Klempnauer.
1991.
Sequence-specific DNA binding by Myc proteins.
Proc. Natl. Acad. Sci. USA
88:4323-4327[Abstract/Free Full Text].
|
| 15.
|
Kirschbaum, B. J.,
P. Pognonec, and R. G. Roeder.
1992.
Definition of the transcriptional activation domain of recombinant 43-kilodalton USF.
Mol. Cell. Biol.
12:5094-5101[Abstract/Free Full Text].
|
| 16.
|
Koskinen, P. J., and K. Alitalo.
1993.
Role of myc amplification and overexpression in cell growth, differentiation and death.
Cancer Biol.
4:3-12.
|
| 17.
|
Kozlowski, M. T.,
L. Gan,
J. M. Venuti,
M. Sawadogo, and W. H. Klein.
1991.
Sea urchin USF: a helix-loop-helix protein active in embryonic ectoderm cells.
Dev. Biol.
148:625-630[Medline].
|
| 18.
|
Krylov, D.,
D. Echlin,
K. Kasai,
H. Arnheiter,
E. Taparowsky, and C. Vinson.
1997.
A general method to design dominant negative to bHLHXZip proteins that abolish DNA binding.
Proc. Natl. Acad. Sci. USA
94:12274-12279[Abstract/Free Full Text].
|
| 19.
|
Krylov, D.,
M. Olive, and C. Vinson.
1995.
Extending dimerization interfaces: the bZIP basic region can form a coiled coil.
EMBO J.
14:5329-5337[Medline].
|
| 20.
|
Land, H.,
L. F. Parada, and R. A. Weinberg.
1983.
Tumorigenic conversion of primary fibroblasts requires at least two cooperating oncogenes.
Nature
304:596-602[Medline].
|
| 21.
|
Lin, Q.,
X. Luo, and M. Sawadogo.
1994.
Archaic structure of the gene encoding transcription factor USF.
J. Biol. Chem.
269:23894-23903[Abstract/Free Full Text].
|
| 22.
|
Luo, X., and M. Sawadogo.
1996.
Antiproliferative properties of the USF family of transcription factors.
Proc. Natl. Acad. Sci. USA
93:1308-1313[Abstract/Free Full Text].
|
| 22a.
| Luo, X. Unpublished observations.
|
| 23.
|
Luo, X., and M. Sawadogo.
1996.
Functional domains of transcription factor USF2: atypical nuclear localization signals and context-dependent transcriptional activation domains.
Mol. Cell. Biol.
16:1367-1375[Abstract].
|
| 24.
|
Meier, J. L.,
X. Luo,
M. Sawadogo, and S. E. Straus.
1994.
The cellular transcription factor USF cooperates with varicella-zoster virus immediate-early protein 62 to symmetrically activate a bidirectional viral promoter.
Mol. Cell. Biol.
14:6896-6906[Abstract/Free Full Text].
|
| 25.
|
Murre, C.,
P. S. McCaw, and D. Baltimore.
1989.
A new DNA binding and dimerization motif in immunoglobulin enhancer binding, daughterless, MyoD and Myc proteins.
Cell
56:777-783[Medline].
|
| 26.
|
Olive, M.,
D. Krylov,
D. R. Echlin,
K. Gardner,
E. Taparowsky, and C. Vinson.
1997.
A dominant negative to activation protein-1 (AP1) that abolishes DNA binding and inhibits oncogenesis.
J. Biol. Chem.
272:18586-18594[Abstract/Free Full Text].
|
| 27.
|
Reisman, D., and V. Rotter.
1993.
The helix-loop-helix containing transcription factor USF binds to and transactivates the promoter of the p53 tumor suppressor gene.
Nucleic Acids Res.
21:345-350[Abstract/Free Full Text].
|
| 28.
|
Sadowki, I.,
J. Ma,
S. Triezenberg, and M. Ptashne.
1988.
GAL4-VP16 is an unusually potent transcriptional activator.
Nature
335:563-564[Medline].
|
| 29.
|
Sadowski, I., and M. Ptashne.
1989.
A vector for expressing Ga14(1-147) fusions in mammalian cells.
Nucleic Acids Res.
17:7539[Free Full Text].
|
| 30.
|
Sawadogo, M.,
M. W. Van Dyke,
P. D. Gregor, and R. G. Roeder.
1988.
Multiple forms of the human gene-specific transcription factor USF. I. Complete purification and identification of USF from HeLa cell nuclei.
J. Biol. Chem.
263:11985-11993[Abstract/Free Full Text].
|
| 31.
|
Scholtz, B.,
M. Kingsley-Kallesen, and A. Rizzino.
1996.
Transcription of the transforming growth factor- 2 gene is dependent on an E-box located between an essential cAMP resopnse element/activation transcription factor motif and the TATA box of the gene.
J. Biol. Chem.
271:32375-32380[Abstract/Free Full Text].
|
| 32.
|
Schreiber, E.,
P. Matthias,
M. M. Muhler, and W. Schaffner.
1989.
Rapid detection of octamer binding proteins with min-extracts prepared from a small number of cells.
Nucleic Acids Res.
17:6419[Free Full Text].
|
| 33.
|
Schulman, I. G.,
C. Li,
J. W. R. Schwabe, and R. M. Evans.
1997.
The phantom ligand effect: allosteric control of transcription by the retinoid X receptor.
Genes Dev.
11:299-308[Abstract/Free Full Text].
|
| 34.
|
Shew, J. Y.,
B. T. Lin,
P. L. Chen,
T. L. Yang-Feng, and W. H. Lee.
1990.
C-terminal truncation of the retinoblastoma gene product leads to functional inactivation.
Proc. Natl. Acad. Sci. USA
87:6-10[Abstract/Free Full Text].
|
| 35.
|
Sirito, M.,
S. Walker,
Q. Lin,
M. T. Kozlowski,
W. H. Klein, and M. Sawadogo.
1992.
Members of the USF family of helix-loop-helix proteins bind DNA as homo- as well as heterodimers.
Gene Expr.
2:231-240[Medline].
|
| 36.
|
Sirito, M.,
Q. Lin,
T. Maity, and M. Sawadogo.
1994.
Ubiquitous expression of the 43- and 44-kDa forms of transcription factor USF in mammalian cells.
Nucleic Acids Res.
22:427-433[Abstract/Free Full Text].
|
| 37.
|
Sirito, M.,
Q. Lin,
J. M. Deng,
R. R. Behringer, and M. Sawadogo.
1998.
Overlapping roles and asymmetrical cross-regulation of the USF proteins in mice.
Proc. Natl. Acad. Sci. USA
95:3758-3763[Abstract/Free Full Text].
|
| 38.
|
Vallet, V. S.,
A. A. Henrion,
D. Bucchini,
M. Casado,
M. Raymondjean,
A. Kahn, and S. Vaulont.
1997.
Glucose-dependent liver gene expression in upstream stimulatory factor 2 / mice.
J. Biol. Chem.
272:21944-21949[Abstract/Free Full Text].
|
| 39.
|
Viollet, B.,
A. M. Lefrancois-Martinez,
A. Henrion,
A. Kahn,
M. Raymondjean, and A. Martinez.
1996.
Immunochemical characterization and transacting properties of upstream stimulatory factor isoforms.
J. Biol. Chem.
271:1405-1415[Abstract/Free Full Text].
|
Molecular and Cellular Biology, February 1999, p. 1508-1517, Vol. 19, No. 2
0270-7306/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Corre, S., Primot, A., Baron, Y., Le Seyec, J., Goding, C., Galibert, M.-D.
(2009). Target Gene Specificity of USF-1 Is Directed via p38-mediated Phosphorylation-dependent Acetylation. J. Biol. Chem.
284: 18851-18862
[Abstract]
[Full Text]
-
Wood, M. A., Walker, W. H.
(2009). USF1/2 Transcription Factor DNA-Binding Activity Is Induced During Rat Sertoli Cell Differentiation. Biol. Reprod.
80: 24-33
[Abstract]
[Full Text]
-
Ciccone, N. A., Lacza, C. T., Hou, M. Y., Gregory, S. J., Kam, K.-Y., Xu, S., Kaiser, U. B.
(2008). A Composite Element that Binds Basic Helix Loop Helix and Basic Leucine Zipper Transcription Factors Is Important for Gonadotropin-Releasing Hormone Regulation of the Follicle-Stimulating Hormone {beta} Gene. Mol. Endocrinol.
22: 1908-1923
[Abstract]
[Full Text]
-
Park, K.-Y., Russo, A. F.
(2008). Control of the Calcitonin Gene-related Peptide Enhancer by Upstream Stimulatory Factor in Trigeminal Ganglion Neurons. J. Biol. Chem.
283: 5441-5451
[Abstract]
[Full Text]
-
Huang, S., Li, X., Yusufzai, T. M., Qiu, Y., Felsenfeld, G.
(2007). USF1 Recruits Histone Modification Complexes and Is Critical for Maintenance of a Chromatin Barrier. Mol. Cell. Biol.
27: 7991-8002
[Abstract]
[Full Text]
-
Ghoneim, C., Soula-Rothhut, M., Blanchevoye, C., Martiny, L., Antonicelli, F., Rothhut, B.
(2007). Activating Transcription Factor-1-mediated Hepatocyte Growth Factor-induced Down-regulation of Thrombospondin-1 Expression Leads to Thyroid Cancer Cell Invasion. J. Biol. Chem.
282: 15490-15497
[Abstract]
[Full Text]
-
Bayele, H. K., McArdle, H., Srai, S. K.S.
(2006). Cis and trans regulation of hepcidin expression by upstream stimulatory factor. Blood
108: 4237-4245
[Abstract]
[Full Text]
-
Crusselle-Davis, V. J., Vieira, K. F., Zhou, Z., Anantharaman, A., Bungert, J.
(2006). Antagonistic Regulation of {beta}-Globin Gene Expression by Helix-Loop-Helix Proteins USF and TFII-I.. Mol. Cell. Biol.
26: 6832-6843
[Abstract]
[Full Text]
-
Yang, M., Peng, H., Hay, J., Ruyechan, W. T.
(2006). Promoter Activation by the Varicella-Zoster Virus Major Transactivator IE62 and the Cellular Transcription Factor USF.. J. Virol.
80: 7339-7353
[Abstract]
[Full Text]
-
Chen, L., Shen, Y. H., Wang, X., Wang, J., Gan, Y., Chen, N., Wang, J., LeMaire, S. A., Coselli, J. S., Wang, X. L.
(2006). Human Prolyl-4-hydroxylase {alpha}(I) Transcription Is Mediated by Upstream Stimulatory Factors. J. Biol. Chem.
281: 10849-10855
[Abstract]
[Full Text]
-
Smith, K. T., Nicholls, R. D., Reines, D.
(2006). The gene encoding the fragile X RNA-binding protein is controlled by nuclear respiratory factor 2 and the CREB family of transcription factors. Nucleic Acids Res
34: 1205-1215
[Abstract]
[Full Text]
-
Dimova, E. Y., Kietzmann, T.
(2006). Cell Type-dependent Regulation of the Hypoxia-responsive Plasminogen Activator Inhibitor-1 Gene by Upstream Stimulatory Factor-2. J. Biol. Chem.
281: 2999-3005
[Abstract]
[Full Text]
-
Zhu, Y., Casado, M., Vaulont, S., Sharma, K.
(2005). Role of Upstream Stimulatory Factors in Regulation of Renal Transforming Growth Factor-{beta}1. Diabetes
54: 1976-1984
[Abstract]
[Full Text]
-
Liby, K., Hock, T., Yore, M. M., Suh, N., Place, A. E., Risingsong, R., Williams, C. R., Royce, D. B., Honda, T., Honda, Y., Gribble, G. W., Hill-Kapturczak, N., Agarwal, A., Sporn, M. B.
(2005). The Synthetic Triterpenoids, CDDO and CDDO-Imidazolide, Are Potent Inducers of Heme Oxygenase-1 and Nrf2/ARE Signaling. Cancer Res.
65: 4789-4798
[Abstract]
[Full Text]
-
Hadjiagapiou, C., Borthakur, A., Dahdal, R. Y., Gill, R. K., Malakooti, J., Ramaswamy, K., Dudeja, P. K.
(2005). Role of USF1 and USF2 as potential repressor proteins for human intestinal monocarboxylate transporter 1 promoter. Am. J. Physiol. Gastrointest. Liver Physiol.
288: G1118-G1126
[Abstract]
[Full Text]
-
Chen, J., Malcolm, T., Estable, M. C., Roeder, R. G., Sadowski, I.
(2005). TFII-I Regulates Induction of Chromosomally Integrated Human Immunodeficiency Virus Type 1 Long Terminal Repeat in Cooperation with USF. J. Virol.
79: 4396-4406
[Abstract]
[Full Text]
-
Renault, M.-A., Jalvy, S., Potier, M., Belloc, I., Genot, E., Dekker, L. V., Desgranges, C., Gadeau, A.-P.
(2005). UTP Induces Osteopontin Expression through a Coordinate Action of NF{kappa}B, Activator Protein-1, and Upstream Stimulatory Factor in Arterial Smooth Muscle Cells. J. Biol. Chem.
280: 2708-2713
[Abstract]
[Full Text]
-
Viney, T. J., Schmidt, T. W., Gierasch, W., Sattar, A. W., Yaggie, R. E., Kuburas, A., Quinn, J. P., Coulson, J. M., Russo, A. F.
(2004). Regulation of the Cell-specific Calcitonin/Calcitonin Gene-related Peptide Enhancer by USF and the Foxa2 Forkhead Protein. J. Biol. Chem.
279: 49948-49955
[Abstract]
[Full Text]
-
Yang, M., Hay, J., Ruyechan, W. T.
(2004). The DNA Element Controlling Expression of the Varicella-Zoster Virus Open Reading Frame 28 and 29 Genes Consists of Two Divergent Unidirectional Promoters Which Have a Common USF Site. J. Virol.
78: 10939-10952
[Abstract]
[Full Text]
-
Wang, S., Skorczewski, J., Feng, X., Mei, L., Murphy-Ullrich, J. E.
(2004). Glucose Up-regulates Thrombospondin 1 Gene Transcription and Transforming Growth Factor-{beta} Activity through Antagonism of cGMP-dependent Protein Kinase Repression via Upstream Stimulatory Factor 2. J. Biol. Chem.
279: 34311-34322
[Abstract]
[Full Text]
-
Rishi, V., Gal, J., Krylov, D., Fridriksson, J., Boysen, M. S., Mandrup, S., Vinson, C.
(2004). SREBP-1 Dimerization Specificity Maps to Both the Helix-Loop-Helix and Leucine Zipper Domains: USE OF A DOMINANT NEGATIVE. J. Biol. Chem.
279: 11863-11874
[Abstract]
[Full Text]
-
Sayasith, K., Bouchard, N., Sawadogo, M., Lussier, J. G., Sirois, J.
(2004). Molecular Characterization and Role of Bovine Upstream Stimulatory Factor 1 and 2 in the Regulation of the Prostaglandin G/H Synthase-2 Promoter in Granulosa Cells. J. Biol. Chem.
279: 6327-6336
[Abstract]
[Full Text]
-
Rahaus, M., Desloges, N., Yang, M., Ruyechan, W. T., Wolff, M. H.
(2003). Transcription factor USF, expressed during the entire phase of varicella-zoster virus infection, interacts physically with the major viral transactivator IE62 and plays a significant role in virus replication. J. Gen. Virol.
84: 2957-2967
[Abstract]
[Full Text]
-
Hadsell, D. L., Bonnette, S., George, J., Torres, D., Klementidis, Y., Gao, S., Haney, P. M., Summy-Long, J., Soloff, M. S., Parlow, A. F., Sirito, M., Sawadogo, M.
(2003). Diminished Milk Synthesis in Upstream Stimulatory Factor 2 Null Mice Is Associated With Decreased Circulating Oxytocin and Decreased Mammary Gland Expression of Eukaryotic Initiation Factors 4E and 4G. Mol. Endocrinol.
17: 2251-2267
[Abstract]
[Full Text]
-
Szentirmay, M. N., Yang, H.-X., Pawar, S. A., Vinson, C., Sawadogo, M.
(2003). The IGF2 Receptor Is a USF2-specific Target in Nontumorigenic Mammary Epithelial Cells but Not in Breast Cancer Cells. J. Biol. Chem.
278: 37231-37240
[Abstract]
[Full Text]
-
Ma, H., Urquidi, V., Wong, J., Kleeman, J., Goodison, S.
(2003). Telomerase Reverse Transcriptase Promoter Regulation During Myogenic Differentiation of Human RD Rhabdomyosarcoma Cells. Mol Cancer Res
1: 739-746
[Abstract]
[Full Text]
-
Moore, M. L., Park, E. A., McMillin, J. B.
(2003). Upstream Stimulatory Factor Represses the Induction of Carnitine Palmitoyltransferase-Ibeta Expression by PGC-1. J. Biol. Chem.
278: 17263-17268
[Abstract]
[Full Text]
-
Chen, W. G., West, A. E., Tao, X., Corfas, G., Szentirmay, M. N., Sawadogo, M., Vinson, C., Greenberg, M. E.
(2003). Upstream Stimulatory Factors Are Mediators of Ca2+-Responsive Transcription in Neurons. J. Neurosci.
23: 2572-2581
[Abstract]
[Full Text]
-
Sun, P., Loh, H. H.
(2003). Transcriptional Regulation of Mouse delta -Opioid Receptor Gene. IKAROS-2 AND UPSTREAM STIMULATORY FACTOR SYNERGIZE IN TRANS-ACTIVATING MOUSE delta -OPIOID RECEPTOR GENE IN T CELLS. J. Biol. Chem.
278: 2304-2308
[Abstract]
[Full Text]
-
Ito, H., Sommer, M. H., Zerboni, L., He, H., Boucaud, D., Hay, J., Ruyechan, W., Arvin, A. M.
(2002). Promoter Sequences of Varicella-Zoster Virus Glycoprotein I Targeted by Cellular Transactivating Factors Sp1 and USF Determine Virulence in Skin and T Cells in SCIDhu Mice In Vivo. J. Virol.
77: 489-498
[Abstract]
[Full Text]
-
Bidder, M., Shao, J.-S., Charlton-Kachigian, N., Loewy, A. P., Semenkovich, C. F., Towler, D. A.
(2002). Osteopontin Transcription in Aortic Vascular Smooth Muscle Cells Is Controlled by Glucose-regulated Upstream Stimulatory Factor and Activator Protein-1 Activities. J. Biol. Chem.
277: 44485-44496
[Abstract]
[Full Text]
-
Al-azzeh, E, Dittrich, O, Vervoorts, J, Blin, N, Gott, P, Luscher, B
(2002). Gastroprotective peptide trefoil factor family 2 gene is activated by upstream stimulating factor but not by c-Myc in gastrointestinal cancer cells. Gut
51: 685-690
[Abstract]
[Full Text]
-
Gupta, A. K., Kone, B. C.
(2002). USF-1 and USF-2 trans-repress IL-1beta -induced iNOS transcription in mesangial cells. Am. J. Physiol. Cell Physiol.
283: C1065-C1072
[Abstract]
[Full Text]
-
Tabuchi, A., Sakaya, H., Kisukeda, T., Fushiki, H., Tsuda, M.
(2002). Involvement of an Upstream Stimulatory Factor as Well as cAMP-responsive Element-binding Protein in the Activation of Brain-derived Neurotrophic Factor Gene Promoter I. J. Biol. Chem.
277: 35920-35931
[Abstract]
[Full Text]
-
Wu, Y.-L., Wiltbank, M. C.
(2002). Transcriptional Regulation of the Cyclooxygenase-2 Gene Changes from Protein Kinase (PK) A- to PKC-Dependence after Luteinization of Granulosa Cells. Biol. Reprod.
66: 1505-1514
[Abstract]
[Full Text]
-
Pastier, D., Lacorte, J.-M., Chambaz, J., Cardot, P., Ribeiro, A.
(2002). Two Initiator-like Elements Are Required for the Combined Activation of the Human Apolipoprotein C-III Promoter by Upstream Stimulatory Factor and Hepatic Nuclear Factor-4. J. Biol. Chem.
277: 15199-15206
[Abstract]
[Full Text]
-
Calomme, C., Nguyen, T. L.-A., de Launoit, Y., Kiermer, V., Droogmans, L., Burny, A., Van Lint, C.
(2002). Upstream Stimulatory Factors Binding to an E Box Motif in the R Region of the Bovine Leukemia Virus Long Terminal Repeat Stimulates Viral Gene Expression. J. Biol. Chem.
277: 8775-8789
[Abstract]
[Full Text]
-
Mansky, K. C., Marfatia, K., Purdom, G. H., Luchin, A., Hume, D. A., Ostrowski, M. C.
(2002). The microphthalmia transcription factor (MITF) contains two N-terminal domains required for transactivation of osteoclast target promoters and rescue of mi mutant osteoclasts. J. Leukoc. Biol.
71: 295-303
[Abstract]
[Full Text]
-
Eberhardy, S. R., Farnham, P. J.
(2001). c-Myc Mediates Activation of the cad Promoter via a Post-RNA Polymerase II Recruitment Mechanism. J. Biol. Chem.
276: 48562-48571
[Abstract]
[Full Text]
-
Chen, Y.-H., Layne, M. D., Watanabe, M., Yet, S.-F., Perrella, M. A.
(2001). Upstream Stimulatory Factors Regulate Aortic Preferentially Expressed Gene-1 Expression in Vascular Smooth Muscle Cells. J. Biol. Chem.
276: 47658-47663
[Abstract]
[Full Text]
-
Matsukawa, T., Inoue, Y., Oishi, Y., Kato, H., Noguchi, T.
(2001). Up-Regulation of Upstream Stimulatory Factors by Protein Malnutrition and Its Possible Role in Regulation of the IGF-Binding Protein-1 Gene. Endocrinology
142: 4643-4651
[Abstract]
[Full Text]
-
Wu, Y.-L., Wiltbank, M. C.
(2001). Transcriptional Regulation of Cyclooxygenase-2 Gene in Ovine Large Luteal Cells. Biol. Reprod.
65: 1565-1572
[Abstract]
[Full Text]
-
Yamada, K., Mizutani, T., Shou, Z., Yazawa, T., Sekiguchi, T., Yoshino, M., Inazu, T., Miyamoto, K.
(2001). Cloning and Functional Expression of an E Box-Binding Protein from Rat Granulosa Cells. Biol. Reprod.
64: 1315-1319
[Abstract]
[Full Text]
-
Samoylenko, A., Roth, U., Jungermann, K., Kietzmann, T.
(2001). The upstream stimulatory factor-2a inhibits plasminogen activator inhibitor-1 gene expression by binding to a promoter element adjacent to the hypoxia-inducible factor-1 binding site. Blood
97: 2657-2666
[Abstract]
[Full Text]
-
Xing, W., Ram Sairam, M.
(2001). Characterization of Regulatory Elements of Ovine Follicle-Stimulating Hormone (FSH) Receptor Gene: The Role of E-Box in the Regulation of Ovine FSH Receptor Expression. Biol. Reprod.
64: 579-589
[Abstract]
[Full Text]
-
Heckert, L. L., Sawadogo, M., Daggett, M. A. F., Chen, J. k.
(2000). The USF Proteins Regulate Transcription of the Follicle-Stimulating Hormone Receptor but Are Insufficient for Cell- Specific Expression. Mol. Endocrinol.
14: 1836-1848
[Abstract]
[Full Text]
-
Wu, K., Jiang, S.-W., Thangaraju, M., Wu, G., Couch, F. J.
(2000). Induction of the BRCA2 Promoter by Nuclear Factor-kappa B. J. Biol. Chem.
275: 35548-35556
[Abstract]
[Full Text]
-
Greenall, A., Willingham, N., Cheung, E., Boam, D. S., Sharrocks, A. D.
(2001). DNA Binding by the ETS-domain Transcription Factor PEA3 Is Regulated by Intramolecular and Intermolecular Protein{middle dot}Protein Interactions. J. Biol. Chem.
276: 16207-16215
[Abstract]
[Full Text]
-
Sun, P., Loh, H. H.
(2001). Transcriptional Regulation of Mouse delta -Opioid Receptor Gene. ROLE OF Ets-1 IN THE TRANSCRIPTIONAL ACTIVATION OF MOUSE delta -OPIOID RECEPTOR GENE. J. Biol. Chem.
276: 45462-45469
[Abstract]
[Full Text]