Previous Article | Next Article 
Molecular and Cellular Biology, May 1999, p. 3312-3327, Vol. 19, No. 5
0270-7306/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
NDD1, a High-Dosage Suppressor of
cdc28-1N, Is Essential for Expression of a Subset of
Late-S-Phase-Specific Genes in Saccharomyces
cerevisiae
Chong Jin
Loy,1
David
Lydall,2 and
Uttam
Surana1,*
Institute of Molecular and Cell Biology,
National University of Singapore, Singapore 117609, Singapore,1 and School of Biological
Sciences, University of Manchester, Manchester M13 9PT, United
Kingdom2
Received 29 October 1998/Returned for modification 3 December
1998/Accepted 25 January 1999
 |
ABSTRACT |
cdc28-1N mutants progress through the G1
and S phases normally at the restrictive temperature but fail to
undergo nuclear division. We have isolated a gene, NDD1,
which at a high dosage suppresses the nuclear-division defect of
cdc28-1N. NDD1 (nuclear division defective) is an essential
gene. Its expression during the cell cycle is tightly regulated such
that NDD1 RNA is most abundant during the S phase. Cells
lacking the NDD1 gene arrest with an elongated bud, a short
mitotic spindle, 2N DNA content, and an undivided nucleus, suggesting
that its function is required for some aspect of nuclear division. We
show that overexpression of Ndd1 results in the upregulation of both
CLB1 and CLB2 transcription, suggesting that
the suppression of cdc28-1N by NDD1 may be due to an accumulation of these cyclins. Overproduction of Ndd1 also enhances the expression of SWI5, whose transcription, like
that of CLB1 and CLB2, is activated in the late
S phase. Ndd1 is essential for the expression of CLB1,
CLB2, and SWI5, since none of these genes are
transcribed in its absence. Both CLB2 expression and its
upregulation by NDD1 are mediated by a 240-bp promoter
sequence that contains four MCM1-binding sites. However,
Ndd1 does not appear to be a component of any of the protein complexes
assembled on this DNA fragment, as indicated by gel mobility shift
assays. Instead, overexpression of NDD1 prevents the
formation of one of the complexes whose appearance correlates with the
termination of CLB2 expression in G1. The
inability of GAL1 promoter-driven CLB2 to
suppress the lethality of NDD1 null mutant suggests that, in addition to CLB1 and CLB2, NDD1
may also be required for the transcription of other genes whose
functions are necessary for G2/M transition.
 |
INTRODUCTION |
An orderly progression through the
cell division cycle requires that the relevant cellular events occur in
a strict temporal sequence. In the budding yeast Saccharomyces
cerevisiae, as in many other organisms, this is achieved by a
combination of transcriptional and posttranslational regulations of
various effectors. One of the best-studied examples of such
posttranslational controls is the way in which the activity of the key
protein kinase Cdc28 is regulated. Phosphorylation of specific tyrosine
and threonine residues (19, 34, 35, 49), the association
with a variety of cyclins (14, 43, 48, 53), and their
proteolytic destruction at various stages of the cell cycle (2, 3,
10, 18) all contribute to sharply define not only the timing of
Cdc28 activation-inactivation but also, presumably, its substrate
specificity (35). Similarly, an anaphase-promoting complex
whose activity is crucial for chromosome segregation appears to be
regulated at the posttranslational level (24, 54, 55).
Although posttranslational modifications of the mitotic regulators are
perhaps the most effective way for the cell to quickly respond to the
changing cellular context, these responses may be further sharpened by
controls at the transcriptional level. Indeed, it has been estimated by
DNA microarray hybridization that about 800 genes of the budding yeast
S. cerevisiae are transcribed only at specific stages of the
cell cycle (50). Many of these periodically transcribed
genes play crucial roles in cell cycle progression. For instance, the
transcripts for the G1 cyclins CLN1 and
CLN2 appear in late G1 phase approximately when
the cells traverse START. The transcription of these genes is regulated by a sequence motif called SCB (Swi4/Swi6 cell cycle box) within their
promoter (22). This motif is also found in the promoters of
the genes encoding HO endonuclease and the cyclin-like
protein Hcs26 (6, 11), which are also expressed in late
G1. A specific heteromeric transcription factor complex
(SCF) containing Swi4 and Swi6 proteins drives the cell cycle
stage-specific expression by binding to the SCB element (37,
38). The S-phase cyclin genes CLB5 and CLB6
and DNA synthesis genes such as POL1, TMP1, and
CDC9 are also expressed in late G1 but their
expression is driven by another promoter element called MCB (Mlu1 cell
cycle box) which binds a transcription factor complex (MBF) containing Mbp1 and Swi6 (23, 28). At the onset of the S phase,
histones and, somewhat later, CLB3 and CLB4
cyclin genes are transcribed (15).
The transcription of another set of genes is activated near the
completion of the S phase. This includes FAR1, a protein
required for pheromone-induced G1 arrest, the transcription
factors SWI5 and ACE2, mitotic cyclin genes
CLB1 and CLB2, and CDC5, a gene encoding a Polo-like protein kinase. It is not clear whether the periodic expression of these genes is regulated by a common promoter element and transcription factors. An analysis of SWI5
promoter revealed a 55-bp element that is sufficient for the periodic
expression of SWI5 (29). It has been proposed
that Mcm1, a DNA-binding protein important for the determination of
mating-type specificity, forms a complex with Sff (SWI5
transcription factor) and binds to this 55-bp promoter element
(29). The gene encoding Sff has not yet been identified. In
subsequent studies, it was shown that Mcm1 is required for the
expression of CLB1, CLB2, SWI5,
CDC5, and ACE2 (1, 30). This is
consistent with the fact that the promoter regions of CLB1,
CLB2, and SWI5 contain consensus Mcm1 binding
sites. Interestingly, Mcm1 occupies these sites throughout the cell
cycle, implying that the timing of expression is perhaps determined
either by specific modifications of the bound factors or by other
associated factors (1). It has been recently reported that a
novel promoter element ECB (early cell cycle box), which renders the
expression of SWI4, CDC6, CDC47, and
CDC46 M/G1 specific, also binds Mcm1
(32). Since Mcm1 is also involved in the regulation of other
cellular processes that are not directly linked to the cell cycle
progression (26, 31, 33, 51), it seems unlikely that Mcm1 is
the critical factor in determining the periodicity of gene expression.
As Cdc28 is the key protein kinase required at various stages for cell
cycle progression, most CDC28 mutants exhibit defects in
progression through both START and G2/M transition
(39, 41). However, cdc28-1N is a unique mutant in
that, although normal with respect to its START functions, it fails to
undergo nuclear division at the restrictive temperature and,
consequently, arrests with a large elongated bud, a short mitotic
spindle, 2N DNA content, high histone H1 kinase activity, and an
undivided nucleus (39, 53). Although the molecular nature of
its mitotic defect is still unknown, the cdc28-1N mutant has
served well for the identification of a number of novel genes.
CLB1, CLB2, and CLB4 were first
isolated as allele-specific, high-dosage suppressors of the
cdc28-1N mutation (53). Similarly,
CIM3 and CIM5 genes encoding the 26S proteosome subunits were identified as mutations that exhibit synthetic lethal behavior in combination with cdc28-1N (17). We
report here the isolation of a novel allele-specific, high-dosage
suppressor of cdc28-1N, termed NDD1, and examine
its role in cell cycle progression. We describe its basic
characterization and show that NDD1 is an essential
component, as is MCM1, of the mechanism that activates the
expression of a set of late-S-phase-specific genes.
 |
MATERIALS AND METHODS |
Yeast strains and growth media.
Yeast strains (Table
1) used in this study were derivatives of
the standard wild-type strain W303. Strain BJ2168 (US1005) was used in
the mobility shift DNA-binding assay. Yeast cells were routinely grown
in yeast extract-peptone medium containing adenine (50 mg/liter)
supplemented with either glucose or galactose. Raffinose was also added
to the galactose medium. All media were prepared as described by Rose
et al. (44).
To obtain cultures synchronized in G
1,
bar1
cells (US356) were treated with

-factor (0.8 µg/ml) for 3 h.
In experiments
where a synchronous release from late telophase was
required,
cdc15 cells were grown to log phase at 24°C
before they were filtered
and resuspended in prewarmed growth medium at
37°C. After 3 h,
cells were allowed to resume cell cycle
progression at 24°C.
Isolation of NDD1.
cdc28-1N cells were
transformed with a library of yeast genomic fragments cloned into the
BamHI site of the YEp13 (2µm) vector (36),
allowed to recover at 24°C for 24 h, and then shifted to 37°C
for 3 days. The plasmids were retrieved from various transformants and
were categorized into seven distinct groups based on the patterns of
fragments generated by restriction enzyme digestion. One group of
plasmids harbored a 2.7-kb PvuII genomic fragment containing the NDD1 gene.
DNA manipulations.
All DNA manipulations were performed as
described by Sambrook et al. (46). The 2.7-kb
PvuII fragment containing the entire NDD1 gene
was blunt-end cloned into the SmaI-BglII site of
pIC19H vector to yield pUS529. To construct the NDD1 gene
under the control of GAL1 promoter, an NcoI site
was created immediately upstream of the ATG start codon by PCR. The
BamHI-BglII fragment from pUS529 was then
replaced by the BamHI-BglII-digested 0.97-kb PCR
product. The complete NDD1 gene was then excised with
NcoI-HindIII and blunt-end ligated to the
GAL1 promoter in a URA3- or
TRP1-selectable CEN vector.
Gene disruptions were performed by using the one-step gene replacement
method of Rothstein (
45) with a 2.7-kb
PvuII
fragment
in which the 450-bp
EcoRV fragment within the open
reading frame
(ORF) was replaced by a 1.6-kb
XhoI-
SalI fragment containing the
LEU2
gene. The disruption of the
NDD1 gene was confirmed by
Southern
blot analysis. To tag
NDD1 with three tandem copies
of the hemagglutinin
(HA) epitope
(GRIFYPYDVPDYAGYPYDVPDYAGSYPYDVPDYAAQC), a
NotI site
was
introduced just after the ATG start codon by PCR. The triple
HA tag (as
a 111-bp
NotI fragment) was cloned into the newly created
NotI site. The resulting HA
3-tagged
NDD1 was excised as an
NcoI-
SmaI
fragment and blunt-end ligated to the
GAL1 promoter in a
TRP1-selectable
CEN vector to yield
pGAL1-HA
3-NDD1.
To test the upstream activation sequence (UAS) activity,
CLB2 promoter sequences were cloned upstream of a
CYC1 TATA box fused
to a
ubiY lacZ reporter,
which expresses

-galactosidase activity
with a half-life of 10 min
instead of more than 20 h (
8). The
340-bp
CLB2 UAS (extending from

863 to

523 bp from ATG) was
generated by PCR and cloned into the
XhoI-
BglII
site of pDL1498
plasmid containing the
ubiY lacZ reporter
(
29) as a
SalI-
BglII
fragment (sites
introduced by PCR). The 240-bp
CLB2 UAS (

863
to

627 bp
from ATG) was made by dropping out a 110-bp
XhoI-
BglII
fragment from the 340-bp
CLB2 UAS reporter construct and religating
the plasmid. The
55-bp
CLB2 UAS (

698 to

643 bp from ATG) was
synthesized
by mutually priming two oligonucleotides
(5'-TACAGAATTCTCGAGAATATAGCGACCGAATCAGGAAAAGGTCAACAACGA-3'
and
5'-ACTGAATTCAGATCTCATCCATATCGCGAACTTCGTTGTTGACCTTTTCC-3')
as
described in Ausubel et al. (
7) and cloned into pDL1498
as a
XhoI-
BglII fragment (sites introduced by PCR).
The recombinant
reporter constructs were excised by
SmaI-
NcoI digestion and blunt-end
cloned into the
EcoRI site of a
URA3-based integrative plasmid
and subsequently integrated at the
URA3 locus by homologous
recombination.
All integration events were checked by Southern blot
analysis,
and

-galactosidase activities were measured in at least
three
independent isolates from each integrative transformation.
Activities
were expressed as Miller
units.
To clone the full-length
NDD1 in frame with the
GAL4 DNA-binding domain of pGBT9 (
9),
NDD1 was excised from pUS529 as a
NcoI-
XhoI fragment and blunt-end ligated into the
SmaI site of
pGBT9. For
GAL4-NDD1 deletion mutant
analysis, all constructs
were made similarly except that different
restriction enzymes
were used to excise the various
NDD1
fragments from pUS529. The
isolated fragments were subsequently cloned
in frame into pGBT9
to yield the various
GAL4-NDD1 deletion
fusion constructs (see
Table
2).
NDD1 lacking the
polyglutamine domain was constructed
by PCR with the following sets of
primers: 5'-TTGATTGGATCCATGGACAGAGATATAAGC-3'
and
5'-TCTGCTGATGCTGCAGTAATATAC-3' to obtain the sequence 5' of
the polyglutamine domain and 5'-TTCTTCTGTTCTGCAGTTCGGCAAC-3'
and
5'-TATTGTTAGATCTTAGCGGCGTTCT-3' to obtain the
sequence 3' of the
polyglutamine domain. The two PCR products were
digested with
NcoI-
PstI and
PstI-
BglII and triple ligated into an
NcoI-
BglII-cut
pUS529. This resulted in a
NDD1
Q construct which lacks amino acids 93 to 143. This construct was
subsequently excised as an
NcoI-
XhoI fragment and blunt-end ligated
in frame
with the
GAL4 DNA-binding domain in
pGBT9.
Random spore analysis.
To determine the terminal phenotype
of cells deficient in NDD1, a diploid strain heterozygous
for ndd1
::LEU2 (US241) was sporulated in
liquid medium. Spores purified by centrifugation (7) were
inoculated into medium lacking leucine. Samples were withdrawn 6 h
after germination and were used for in situ immunofluorescence and photomicroscopy.
Gel mobility shift assay.
Yeast protein extracts were
prepared from protease-deficient (pep4
)
strains essentially as described by Company et al. (12).
Double-stranded DNA probes were prepared by using the Klenow enzyme to
fill in the protruding 5' end of a restriction site in the presence of radioactive [
-32P]dATP. The labelled probes were
purified from the unincorporated nucleotides by using NucTrap probe
purification columns (Stratagene). DNA binding reactions were carried
out in 1.5-ml Eppendorf tubes. Generally, 10,000 to 20,000 cpm
(Cerenkov) of probe was used for each reaction. Each reaction contained
4 µl of 5× BS buffer (100 mM Tris-HCl [pH 7.5], 250 mM NaCl, 15 mM
MgCl2, 5 mM dithiothreitol, 25 mM spermidine, 250 µg of
bovine serum albumin per ml, 100 mM EDTA), 2 µl of 50% glycerol, 2.5 µl of a 1-mg/ml concentration of poly(dI-dC), radiolabelled probe,
water, and 20 µg of protein extract to give a final volume of 20 µl. Protein extracts were always added last, and the reactions were
incubated at 24°C for 15 min followed by a further 15 min of
incubation at 4°C. Conditions for competition experiments were
exactly the same except that cold competitor DNAs were added to the
reaction mixture before the addition of radiolabelled probe. For
antibody supershift assays, the appropriate antibodies were added 6 min
after the addition of the protein extracts and processed as described
above. The gel used for resolving the protein-DNA complexes was 4%
(20:1) acrylamide-bisacrylamide gel in 0.5× Tris-borate-EDTA (TBE).
The gels were prerun at 4°C for 2 h at 200 V (~20 mA) in 0.5×
TBE. After incubation, the reaction mixtures were loaded onto the gel and run at 4°C for 3 h at 200 V (~8 mA). The gels were dried
and autoradiographed with an intensifying screen at
70°C.
Other techniques.
The lithium acetate method was used for
all yeast transformations. Total RNA was isolated as described by Cross
and Tinkelenberg (13), and Northern (RNA) blot analyses were
performed as described by Price et al. (40). The method of
Kilmartin and Adams (21) was used for immunofluorescence and
photomicroscopy. DNA distribution analysis by flow cytometry was
performed as described by Lim et al. (27).
 |
RESULTS |
NDD1 is an allele-specific suppressor of the
cdc28-1N mutation.
Most CDC28 mutants
(i.e., cdc28-1, cdc28-4, and cdc28-13)
are predominantly defective in traversing START and therefore arrest in
late G1 phase as unbudded cells with 1N DNA content
(20, 42). Some of them also exhibit a defect in progression
through mitosis (39, 41). The cdc28-1N mutant is
unique in that it progresses through START and S phase normally but
fails to undergo nuclear division at the nonpermissive temperature,
despite the high Clb2-associated histone H1 kinase activity (39,
53). We isolated NDD1 in a genetic screen designed to
identify genes whose overexpression can suppress the mitotic defect of
cdc28-1N mutant. To determine whether NDD1
overexpression causes suppression of other cdc28 mutations,
a high-copy-number (2µm) vector carrying NDD1 was
introduced into both cdc28-4 and cdc28-1N
mutants, and the transformants were tested for growth at 37°C. While
NDD1 allowed growth of cdc28-1N cells at 37°C,
it failed to suppress the cdc28-4 mutation (Fig.
1A). Overexpression of NDD1
also failed to suppress the cdc28-4 mutation
when tested at 31 and 35°C (data not included). Hence,
NDD1 is an allele-specific suppressor of the
cdc28-1N mutation. This behavior is identical to that of the
mitotic cyclin genes CLB1 and CLB2, which were
isolated in the same screening (53). This suggests that the
role of NDD1 is related to the mitotic function of
CDC28.


View larger version (131K):
[in this window]
[in a new window]
|
FIG. 1.
(A) NDD1 is an allele-specific suppressor of
the cdc28-1N mutation. cdc28-4 and
cdc28-1N cells were transformed with YEp13 (2µm) or the
vector containing NDD1 as the 2.7-kb PvuII
fragment. The transformants were plated on leucine-deficient plates and
incubated at 24 or 37°C for 48 h. (B) Nucleotide sequence and
the predicted amino acid sequence of NDD1. The polyglutamine
stretch is shown in boldface, and the three well-conserved
cdc2/CDC28 histone H1 phosphorylation sites are
underlined.
|
|
NDD1 gene, located on chromosome XV, contains a 1.66-kb ORF
(
Saccharomyces Genome Database ORF sequence YOR372c) that
encodes
a protein of 554 amino acids (Fig.
1B) with no significant
overall
homology to any known protein in the databases. The protein
contains
an unbroken stretch of 15 glutamine residues in its N
terminus.
The glutamine stretches are found in a number of proteins
with
diverse functions, including some transcription activators, but
the precise role this motif serves in these proteins is not known.
At
least in the case of Ndd1, the glutamine tract does not seem
to play a
crucial role for Ndd1 function, since Ndd1 lacking this
stretch can
complement
NDD1-null mutant and is also able to suppress
cdc28-1N mutation (see below). Ndd1 also contains three
putative
Cdc28 phosphorylation sites in the middle region, but their
relevance
to Ndd1 function is not clear. As there are no other features
that match any of the known motifs, the amino acid sequence of
Ndd1
currently provides no clues to its possible
function.
NDD1 is an essential gene whose function is required
during mitosis.
To determine whether NDD1 is necessary
for cell viability, the ORF in one of the two copies of NDD1
in a wild-type diploid was replaced by the LEU2 gene (Fig.
2A). The resulting heterozygous mutant
(US241) was allowed to sporulate, and the tetrads were dissected on
rich medium. Only two spores in each tetrad survived and gave rise to
normal colonies that failed to grow when replica plated on
leucine-deficient medium. By inference, the absence of viable
Leu+ segregants in these dissections suggests that all
segregants that were Leu+ and therefore lacked intact
NDD1 ORF were nonviable. Microscopic examination of these
segregants revealed that the spores had germinated but that most had
arrested as large-budded cells, while others had undergone one or two
divisions before cessation of growth. This suggests that
NDD1 is essential for vegetative growth.

View larger version (38K):
[in this window]
[in a new window]
|
FIG. 2.
NDD1 is an essential gene. (A) Partial
restriction map of the 2.7-kb PvuII fragment containing
NDD1. The 0.45-kb EcoRV fragment in the ORF was
replaced by the LEU2 gene to generate the disruption mutant
ndd1 ::LEU2. The scale bar is in base pairs.
Diploid cells heterozygous for ndd1 ::LEU2
disruption were sporulated and dissected on rich medium. Tetrads show a
2:2 segregation pattern for viability. All survivors were
Leu . (B) Cell cycle arrest phenotype of
ndd1 . Spores from a wild-type diploid strain or an
ndd1 ::LEU2 heterozygous diploid strain were
purified and germinated in either complex medium or medium lacking
leucine, respectively. Samples were withdrawn 6 h after
germination and used for differential-interference-contrast (DIC)
microscopy, staining with anti-tubulin antibodies, and DAPI
(4',6-diamidino-2-phenylindole) staining. The lower panel shows DNA
distribution profiles of asynchronously growing wild-type and
Ndd1-depleted cells.
|
|
To characterize the cell cycle arrest phenotype of
NDD1-deficient cells, diploid cells heterozygous for
NDD1 disruption (US241)
were grown in YPD medium and then
transferred to sporulation medium.
After 20 h, spores were
purified and inoculated into medium lacking
leucine to allow
germination and growth of only those spores in
which the
NDD1 ORF had been replaced by the
LEU2 gene.
Immunofluorescence
microscopy revealed that
NDD1-deficient
cells arrested with a
large, elongated bud, an undivided nucleus, and a
short mitotic
spindle (Fig.
2B). In a parallel experiment,
NDD1-deficient haploid
cells kept alive by a
CEN
vector carrying
GAL-NDD1 (US262) was
first grown in
galactose and then transferred to glucose medium.
At the end of 6 h, the cells had arrested, with a phenotype identical
to that observed
in the spore outgrowth experiment. Fluorescence-activated
cell sorter
analysis showed that these cells had arrested with
2N DNA content (Fig.
2B). Thus,
NDD1-deficient cells are capable
of bud
emergence, DNA replication, and spindle formation, but
they fail to
proceed to anaphase. This suggests that
NDD1 is essential
for some aspect of nuclear
division.
Expression and localization of Ndd1 during the cell cycle.
Since NDD1 appeared to be necessary for the nuclear division
process, we asked whether its expression is restricted to this stage of
the cell cycle. Exponentially growing wild-type cells were synchronized
in G1 by
-factor treatment for 3 h at 25°C and
then allowed to resume cell cycle progression in
-factor-free medium. Total RNA was isolated, and NDD1-specific transcript
was detected by Northern blot analysis. The NDD1 RNA, first
detectable above the basal level at 30 min after the release from
G1 arrest, peaks at 50 to 60 min and then declines ca. 30 min before the majority of cells reach anaphase (Fig.
3A). The transcript appears again in the
next cycle when the proportion of cells with anaphase spindle has reached its minimum. The window of NDD1
expression lies between the peaks of CLN1 and
CLB2 transcription (Fig. 3A), a period that corresponds to
the S phase. It is not yet clear as to what restricts NDD1
transcription to the S phase. So far we have not found any known
cis-regulatory elements within the 2-kb region upstream of
the ORF except one loosely conserved SCB (Swi4/Swi6 cell cycle box) in
reverse orientation.


View larger version (116K):
[in this window]
[in a new window]
|
FIG. 3.
(A) NDD1 gene expression during the cell
cycle. Wild-type cells lacking BAR1 gene were arrested in
G1 by -factor treatment and then released into growth
medium without -factor. Samples were withdrawn at 10-min intervals,
and total RNA was analyzed by Northern blotting with an internal
EcoRI fragment of NDD1 as a probe.
CLN1 and CLB2 RNA transcripts are also shown for
comparison. The amount of total RNA loaded (30 µg) was visualized by
methylene blue staining of the rRNAs. The graph at the bottom shows the
percentage of cells with anaphase spindles after release. (B) Nuclear
localization of the Ndd1-lacZp. Wild-type cells carrying
pGAL1-NDD1-lacZ were grown in glucose or galactose medium and then used
for both indirect immunofluorescence staining with
anti- -galactosidase antibodies (upper panels) and nuclear staining
with DAPI (lower panels).
|
|
To determine the cellular location of Ndd1 protein,
NDD1-ORF
was fused in frame with the gene encoding

-galactosidase and
put
under the control of
GAL1 promoter on a
CEN
plasmid. This
fusion construct was fully functional, since a
NDD1 null mutant
harboring this plasmid grew normally on
galactose but remained
nonviable in glucose medium. Wild-type cells
carrying the fusion
construct were grown in galactose medium for 3 h and then fixed
with formaldehyde. Immunofluorescence staining with
anti-

-galactosidase
antibodies showed brightly stained nuclei (Fig.
3B). No nuclear
staining was observed in cells expressing only

-galactosidase
from
GAL1 promoter (not shown). This
implies that Ndd1 is a nuclear
protein (Fig.
3B). The protein was
always seen in the nucleus,
irrespective of both the bud size and the
state of nuclear division,
suggesting that nuclear localization of Ndd1
is perhaps not cell
cycle stage
dependent.
Overexpression of Ndd1 enhances the expression of CLB1,
CLB2, and SWI5 genes.
It is known that
elevated levels of the B-type cyclins Clb1, Clb2, and Clb4 can suppress
the nuclear division defect of the cdc28-1N mutant
(53). We reasoned that any gene whose overexpression can
cause the accumulation of these cyclins, either by upregulation of
transcription or by increasing their stabilization, would also be
identified by our genetic screen. Therefore, we tested NDD1 for its ability to enhance the transcription of CLB1 and
CLB2. Wild-type cells carrying GAL-NDD1 on a
CEN plasmid (US737) were grown in raffinose medium (in which
GAL1 promoter is not active) for 3 h and then one-half
of the culture was induced to express Ndd1 by the addition of
galactose. Total RNA was prepared at various time points and analyzed
for the presence of CLB1, CLB2, CLB3, SWI5, CDC20, and NDD1 transcripts. Of
these, the CLB1, CLB2, SWI5, and
CDC20 genes are transcribed in late S/G2 phase,
whereas CLB3 is expressed slightly earlier (22).
The transcription of CLB1, CLB2, and
SWI5 continues throughout mitosis and is switched off as the
cells exit from mitosis (29, 53). URA3 served as
an internal control for equal RNA loading since it is transcribed constitutively during the cell cycle. The overexpression of
NDD1 did not cause any change in the level of the
CLB3, CDC20, and URA3 transcripts.
However, there was a three- to fivefold increase in the steady-state
levels of CLB1 and CLB2 RNA (Fig.
4A). The SWI5 expression was
also noticeably enhanced (Fig. 4A). CDC5 and ACE2
are two other genes that are expressed in late-S/G2 phase, but their expression is not affected by the overexpression of NDD1 (data not shown). Thus, NDD1 modulates
expression of only a subset of the late-S/G2 genes. These
data also suggest that the ability of NDD1 to suppress the
cdc28-1N mutation is perhaps linked to its capacity to
augment the expression of the mitotic cyclins CLB1 and
CLB2.

View larger version (52K):
[in this window]
[in a new window]
|
FIG. 4.
(A) Overexpression of NDD1 results in
enhanced expression of CLB1, CLB2, and
SWI5. A wild-type strain containing pGAL1-NDD1 was grown to
mid-log phase in raffinose medium. While one-half of the culture
continued to grow in raffinose medium (left lanes), the other half was
induced by the addition of galactose to express Ndd1 (right lanes).
Total RNA was prepared from samples withdrawn at 2-h intervals and
analyzed by Northern blotting for CLB1, CLB2, and
SWI5 transcripts. CLB3 and CDC20 RNA
transcripts are also shown for comparison. (B) NDD1
overexpression does not abrogate the cell-cycle-regulated transcription
of CLB2. cdc15 cells carrying either a control plasmid
(upper panel) or a plasmid harboring pGAL1-NDD1 (lower panel) were
synchronized in telophase by growth in raffinose medium at 37°C for
2 h. NDD1 expression was induced for 2 h by the
addition of galactose before the cells were released into galactose
medium at 25°C. Samples were withdrawn at 15-min intervals and then
analyzed by Northern blotting with CLB2-specific probe. The
amount of total RNA loaded (30 µg) was visualized by methylene blue
staining of the rRNAs.
|
|
The increase in the steady-state level of
CLB1 and
CLB2 RNAs may be because
NDD1 overexpression
abolishes the cell cycle regulation
of these cyclins so that they are
constitutively expressed in
response to excess Ndd1. To test this,
cdc15 cells carrying
GAL-NDD1 on a
CEN
vector (US1354) were grown in raffinose medium at 25°C
and then
synchronized in telophase by incubation at 37°C for 2
h. Cells
were induced to produce
NDD1 for the next 2 h by the
addition of galactose before they were allowed to resume cell
cycle
progression at 25°C in galactose medium. In a control experiment,
cdc15 cells carrying a vector without
GAL-NDD1
were subjected
to an identical experimental regimen. When released from
telophase
arrest,
cdc15 cells traverse the cell cycle in a
highly synchronous
manner (
52). Total RNA was prepared at
various time points and
was analyzed for the presence of
CLB2 transcript by Northern blotting.
As expected,
CLB2 expression in cells without
GAL-NDD1 showed
characteristic undulation such that it is switched off 30 min
after the
release from telophase and is turned on again when the
cells are well
into the next cycle (Fig.
4B). The overexpression
of
NDD1
from
GAL1 promoter does not change this pattern; instead
it
causes a three- to fivefold increase in the overall expression
of
CLB2 (Fig.
4B). Thus, excess
NDD1 amplifies the
CLB2 expression
but does not abrogate its cell cycle
regulation.
NDD1 is essential for CLB1,
CLB2, and SWI5 expression.
Since Ndd1 can
modulate the expression of CLB1, CLB2, and
SWI5, we asked whether NDD1 is essential for the
transcription of these genes. Since our efforts to isolate a
"tight" temperature-sensitive allele of NDD1 were not
successful, we used for these experiments an ndd1
strain
kept alive by a CEN plasmid carrying GAL-NDD1 (US262). When transferred to glucose medium, this strain exhibits an
arrest phenotype within 4 to 5 h. The cells were first grown in
galactose until they reached log phase and were then shifted to glucose
medium to switch off the NDD1 expression. Total RNA was
isolated from samples withdrawn at various time intervals and analyzed
for the presence of CLB1, CLB2, SWI5,
CLB3, CDC20, NDD1, and URA3
RNAs by Northern blotting. The cells began to exhibit their
characteristic terminal phenotype after 5 h and thereafter remained arrested with 2N content DNA, a short mitotic spindle, and an
undivided nucleus. While the CLB3, CDC20, and
URA3 transcripts were present throughout the course of the
experiment, the CLB1, CLB2, and SWI5
RNAs became undetectable within 4 h of shifting to glucose medium
and remained so for the remainder of the time course (Fig.
5A). As expected, NDD1 was not
transcribed during this period. These results suggest that
NDD1 is essential for the transcriptional activation of
CLB1, CLB2, and SWI5 genes but not for
the expression of CLB3 or CDC20.

View larger version (44K):
[in this window]
[in a new window]
|
FIG. 5.
(A) NDD1 is required for the normal
expression of CLB1, CLB2, and SWI5.
ndd1 ::LEU2 cells carrying pGAL1-NDD1 were
grown to log phase in galactose medium. After 3 h, NDD1
expression from the GAL1 promoter was terminated by
transferring the cells into glucose medium. RNA samples were taken
after 4, 6, 8, and 10 h of incubation in glucose and then analyzed
by Northern blotting with CLB1-, CLB2-, and
SWI5-specific probes. CLB3 and CDC20
RNA transcripts are also shown for comparison. (B) Overexpression of
CLB2 does not suppress the
ndd1 ::LEU2 null mutation.
ndd1 ::LEU2 cells, whose growth is dependent on
wild-type NDD1 on a URA3 plasmid, were
transformed with either TRP1-based control vector or
TRP1 vector carrying either GAL1-CLB2 or
GAL1-NDD1. Transformants were streaked onto galactose medium
containing 5-FOA to counter-select for the URA3-based
plasmid and to induce NDD1 expression from the
GAL1 promoter. After incubation at 24°C for 3 days, only
the cells carrying pGAL1-NDD1 survived.
|
|
Clb1 and Clb2 are B-type cyclins that associate with the protein kinase
Cdc28 and govern its mitotic activity (
16,
53).
Cells
lacking either
CLB1 or
CLB2 are viable but the
clb1
clb2
double mutant is unable to
proceed through mitosis and arrest
with a short spindle, an undivided
nucleus, and 2N DNA content
(
53). This phenotype is very
similar to that of the
ndd1
mutant.
Since
NDD1
is required for
CLB1 and
CLB2 transcription, it
is
possible that the nonviability of
ndd1
mutant may be
entirely
due to a lack of these mitotic cyclins. To test this, we
performed
a plasmid shuffle experiment in which a
TRP1-selectable
CEN plasmid
carrying either
GAL-CLB2 or
GAL-NDD1 was introduced into an
ndd1
mutant kept alive by the native-promoter-driven
NDD1 on a
URA3-selectable
vector. The
transformants were plated on galactose medium containing
5-fluoro-orotic acid (5-FOA) to select for clones that had lost
the
URA3 vector bearing
NDD1 but that expressed
either
GAL-NDD1 or
GAL-CLB2. While the cells
containing
GAL-NDD1 grew readily
on 5-FOA plates, the strain
harboring
GAL-CLB2 did not give rise
to any colonies (Fig.
5B), suggesting that Clb2 overexpression
alone cannot compensate for
the absence of Ndd1. Hence, the lethality
caused by
NDD1
deficiency is not solely due to the lack of mitotic
cyclins. This
implies that, in addition to
CLB1 and
CLB2,
NDD1 may also be required for the expression of other genes
whose function
is necessary for the G
2/M
transition.
Transcriptional activation by NDD1.
Since our results
raise the possibility that Ndd1 may be a transcription activator, we
tested its ability to activate transcription in a heterologous context
by using a yeast one-hybrid assay. The NDD1 coding region,
fused in frame with the DNA-binding domain of the transcription factor
GAL4, was put under the control of the ADH
promoter and was transformed into a tester strain that carried the
lacZ and HIS3 genes as reporters, both driven by
three copies of a 17-mer Gal4-binding sequence. The
Gal4-Ndd1 fusion was able to activate transcription of the
reporter constructs, resulting in both the appearance of
His+ colonies and the expression of
-galactosidase (data
not shown).
It has been shown previously that
MCM1 participates in the
mechanism that coordinates the expression of a group of genes
(including
CLB1,
CLB2, and
SWI5) whose
transcription is activated during
the late-S/G
2 phase of
the cell cycle (
1). In light of our
observation that
NDD1 is required for the transcription of a subset
of these
genes and that it can activate transcription in the yeast
one-hybrid
assay, it is possible that
NDD1 interacts functionally
with
MCM1. Indeed, a multicopy vector (2µm) carrying
native-promoter-driven
NDD1, although not able to support
growth of the
mcm1 mutant cells
at 37°C, does allow them
to grow at 35°C (
1a). Thus, excess
NDD1 is able
to suppress, to some extent, the lethality caused
by the lack of Mcm1
function.
Normal periodic transcription of CLB2 requires a 240-bp
promoter sequence.
Maher et al. (30) have described a
55-bp UAS within the CLB2 promoter which contains one
consensus Mcm1 binding site [DCCY(A/T)(A/T)(T/A)NN(G/A)G; D
C, Y = T or C] (25) and is both necessary and
sufficient for the cell-cycle-regulated expression of CLB2.
This 55-bp UAS is similar to a 55-bp element in the SWI5
promoter in both its sequence and its ability to bind a Mcm1-containing
ternary complex (30).
In addition to the one Mcm1 consensus element (MCE) and an Sff response
element (SFRE) in the 55-bp UAS, there are four other
MCEs in the
CLB2 promoter. The relative positions of these elements
are
shown in Fig.
6A. Some of our initial
experiments had led
us to suspect that the previously
documented 55-bp UAS (
30)
may not be sufficient for the
normal cell-cycle-regulated expression
of
CLB2. We reasoned
that MCEs contained within the sequences
flanking the 55-bp UAS might
also be required. We therefore compared
the 55-, 240-, and 340-bp
promoter fragments, which contained
one, four, and five MCEs,
respectively, for their ability to regulate
transcription of a reporter
gene. The promoter fragments were
placed immediately upstream of the
CYC1 TATA box linked to a reporter
gene
ubiY lacZ
(
29), and these constructs were subsequently
integrated in
chromosome I at the
URA3 locus in wild-type cells.
Constructs without any UAS ("dead") or with the 55-bp UAS of
SWI5 gene were used as negative and positive controls,
respectively.
To determine the pattern of
lacZ expression at
various stages
of the cell cycle, the growth of wild-type cells
carrying these
constructs was arrested by treatment with

-factor
(late G
1),
hydroxyurea (early S phase), or nocodazole
(pre-nuclear division).
Total RNA was prepared and analyzed by Northern
blotting for the
presence of both
lacZ and the endogenous
CLB2 transcripts. The
240-bp, 340-bp, and
SWI5
UAS fragments were all able to drive
the
lacZ expression in
cycling, hydroxyurea (HU)- and nocodazole
(NOC)-arrested cells but were
transcriptionally silent in

-factor-treated
cells (Fig.
6B). This
expression pattern closely matches with
that of the endogenous
CLB2 RNA, except that the level of
lacZ transcription from the recombinant constructs is somewhat lower.
The
55-bp fragment of
CLB2 promoter, however, failed to activate
lacZ transcription in all instances (Fig.
6B). Identical
results
were obtained when the reporter constructs were tested on 2µm
vectors (results not shown).



View larger version (124K):
[in this window]
[in a new window]
|
FIG. 6.
(A) The 340-bp region of the CLB2 promoter.
The 5' flanking region of CLB2 gene from 870 to 520 bp
is shown. The boxed region indicates the presumptive 55-bp core
promoter sequence. Mcm1 binding sites (MCE I, II, III, IV, and V) are
indicated by arrows. Sff binding sites (SFRE) are indicated by dashed
lines. The endogenous XhoI site is also shown. (B)
Cell-cycle-regulated CLB2 transcription requires 240-bp
( 863 to 627) CLB2 UAS. To test the UAS activity at
different stages of the cell cycle, cells carrying a single, integrated
copy of the various UAS-ubiY lacZ reporter fusions were
arrested in -factor ( F), HU, or NOC. RNA samples were taken and
analyzed by Northern blotting for lacZ and CLB2
transcripts. The amount of total RNA loaded (30 µg) was visualized by
methylene blue staining of the rRNAs. The designations are as follows:
dead, ubiY lacZ reporter without UAS sequences; 55 bp,
CLB2 UAS[ 698 to 643]-ubiY lacZ;
240 bp, CLB2 UAS[ 863 to
627]-ubiY lacZ; 340 bp, CLB2
UAS[ 863 to 523]-ubiY lacZ; and SWI5, 55-bp
SWI5 UAS-ubiY lacZ. (C) Pattern of gene
expression from the 240-bp CLB2 UAS and the endogenous
CLB2 promoter. Cells carrying one integrated copy of 240-bp
CLB2 UAS-ubiY lacZ reporter gene were first
arrested in G1 with -factor treatment (1 µg/ml) at
24°C and then allowed to resume cell cycle progression in medium
without -factor. RNA samples were collected at 10-min intervals and
analyzed by Northern blotting for lacZ and endogenous
CLB2 RNA expression. The amount of total RNA loaded (30 µg) was visualized by methylene blue staining of the rRNAs. The
degree of synchrony was measured in terms of the proportion of cells
with anaphase spindles (lower panel).
|
|
To confirm that the 240-bp fragment can regulate
lacZ
expression during the progression through the cell cycle, cells
containing
an integrated copy of the 240-bp-driven
ubiY lacZ
were first synchronized
in G
1 by

-factor treatment and
then allowed to traverse the cell
cycle in

-factor-free medium.
Total RNA was isolated from samples
collected at various times and
analyzed for the presence of the
lacZ and endogenous
CLB2 RNAs by Northern blotting. As in the
case of cells
arrested at various stages of the cell cycle, the
pattern of
lacZ expression in synchronously cycling cells is
indistinguishable
from that of endogenous
CLB2 gene (Fig.
6C), except that the level
of
lacZ expression is lower in
the second cycle. These results
suggest that the 240-bp promoter
fragment, but not the 55-bp element,
is sufficient for the
cell-cycle-regulated expression of
CLB2.
The 240-bp fragment mediates potentiation of CLB2
expression by NDD1 overexpression.
Since the 240-bp
sequence is sufficient to impose cell cycle regulation on
CLB2 transcription, we asked whether the enhancement of
CLB2 expression by excess Ndd1 is effected through this
promoter fragment. Therefore, we compared the efficacy of the 55-, 240-, and 340-bp fragments to elicit the upregulation of
CLB2 transcription. A CEN vector carrying
GAL-NDD1 was introduced into wild-type strains containing
ubiY lacZ reporters driven by the various promoter fragments
(described in the preceding section) at the URA3 locus. The
cells were first grown in raffinose medium and then induced to express
NDD1 for 2 h by the addition of galactose. The total RNA was analyzed for the presence of lacZ and the endogenous
CLB2 transcripts. Whereas no lacZ RNA was
detected when the reporter construct was under control of the 55-bp
fragment, both the 240- and the 340-bp-fragment-driven reporters were
transcribed to a readily detectable level (Fig.
7). The transcription from both the 240- and the 340-bp constructs was upregulated in response to the
overexpression of NDD1 (Fig. 7). All three strains
transcribed the endogenous CLB2 gene and, as expected, the
expression was enhanced when Ndd1 was overexpressed. Hence, Ndd1 exerts
its effect on CLB2 transcription via the 240-bp promoter
sequence.

View larger version (70K):
[in this window]
[in a new window]
|
FIG. 7.
Enhancement of CLB2 transcription by excess
Ndd1 requires the 240-bp CLB2 UAS. Strains containing the
55-, 240-, or 340-bp CLB2 UAS-ubiY lacZ reporter
were transformed with pGAL1-NDD1 and grown in raffinose
medium to mid-log phase. Galactose was then added to induce
overexpression of NDD1 from the GAL1 promoter.
RNA samples were withdrawn after galactose induction (at 0 and 2 h, respectively) and analyzed by Northern blotting with
lacZ- and CLB2-specific probes. The amount of
total RNA loaded (30 µg) was visualized by methylene blue staining of
the rRNAs.
|
|
Ndd1 prevents formation of protein complexes on the 240-bp
sequence, whose absence correlated with the expression of Clb2.
Our results thus far strongly suggest that the 240-bp promoter fragment
mediates both the cell-cycle-regulated expression of CLB2
and its potentiation by excess Ndd1. To determine whether Ndd1 is
recruited to the protein complexes assembled on this
cis-regulatory sequence, a radioactively labelled 240-bp
fragment and the protein extract from cells expressing
native-promoter-driven, fully functional HA3-NDD1 were analyzed in a gel mobility shift
assay. The assay yielded four specific complexes (designated I, II,
III, and IV) (Fig. 8A, left panel, lane
2), all of which disappeared when challenged with a molar excess of
nonradioactive probe (Fig. 8A, left panel, lane 6). However, when a
molar excess of nonradioactive 55-bp fragment was used to challenge the
binding, complex IV (and to some extent complexes I and II) was
abrogated. This suggests that this particular complex is assembled on
the core 55-bp region of the 240-bp fragment (Fig. 8A, right panel,
lane 4). Complexes I, II, and IV contained Mcm1 because inclusion of
anti-Mcm1 antibodies in the binding reactions abolished their formation
(Fig. 8A, left panel, lane 5). Mcm1 is perhaps also present in complex
III since anti-Mcm1 antibodies diminish, though do not abolish, its
formation. However, anti-HA antibodies failed to supershift any of the
complexes, indicating that Ndd1 is not present in these complexes (Fig.
8A, left panel, lanes 3 and 4). The failure of anti-HA antibodies to
elicit any supershift in our experiments is not due to their general
ineffectiveness in gel retardation assays, since the same antibodies
(12CA5) have been shown to cause supershifts in a variety of different
contexts (37a).

View larger version (58K):
[in this window]
[in a new window]
|
FIG. 8.
(A) DNA-protein complexes formed on 240-bp
CLB2 UAS do not contain Ndd1. Radioactively labelled
double-stranded 240-bp CLB2 UAS probe was used for gel
retardation assays. The probe was mixed with 20 µg of protein
extracts prepared from pep4 cells carrying
native-promoter-driven HA3-NDD1. The
designations are as follows: I, II, III, and IV, specific DNA-protein
complexes I, II, III, IV; NS, nonspecific band; F, free probe. Antibody
supershift reactions were performed with HA- or Mcm1-specific
antibodies (left panel, lanes 3, 4, and 5). For competition, excess
nonradioactive 240- or 55-bp competitor probe was added to the reaction
prior to the addition of radiolabelled probe (left panel, lane 6; right
panel, lanes 3 and 4). (B) Appearance of N complex on 240-bp
CLB2 UAS coincides with the absence of CLB2
expression. Exponentially growing (cyc) pep4
cells were synchronized either in G1 phase, S phase, or
mitosis by -factor ( F), HU, or NOC treatments, respectively.
Protein extracts made from these cultures were incubated with
radiolabelled 240-bp CLB2 UAS probe (upper panel).
Designations for the major, specific DNA-protein complexes are as in
panel A. The antibody supershift reaction was performed with
Mcm1-specific antibodies (lane 7). RNA samples from the cultures were
analyzed by Northern blotting with CLB2-specific probe. The
amount of total RNA loaded (30 µg) was visualized by methylene blue
staining of the rRNAs. (C) HA-Ndd1 is unstable in G1.
cdc15 cells carrying pGAL1-HA3-NDD1 were first
synchronized in telophase by growth at 37°C and then released into
25°C to resume cell cycle progression as described in the text.
Samples were withdrawn at 15-min intervals, and the stability of
HA-Ndd1 was monitored by Western blotting with anti-HA antibodies
(12CA5). Clb2 protein was detected with anti-Clb2 antibodies. The
amount of Cdc28 protein, whose level remains constant throughout the
cell cycle, shows equal loading of samples in all lanes. (D)
Conditional overexpression of Ndd1 in G1 prevents formation
of N complex. pep4 cells carrying three
integrated copies of GAL1-NDD1 were arrested in
G1 by -factor treatment in raffinose medium at 24°C.
After 2 h, glucose was added to one-half of the culture, while the
other half was induced for 2 h to express Ndd1 by the addition of
galactose. Protein extracts made from these cells were used for gel
retardation assay by employing radiolabelled 240-bp CLB2 UAS
as a probe. Antibody supershift was performed with Mcm1-specific
antibodies (lane 5). For competition, excess nonradioactive 240-bp
competitor probe was added to the reaction prior to the addition of
radiolabelled probe (lane 6).
|
|
If Ndd1 does not appear to physically associate with the protein
assemblage on the 240-bp promoter sequence, then how does
it modulate
the expression of
CLB2 and the other target genes?
To
address this question, we first compared the pattern of protein
complexes formed on the 240-bp fragment during the stages when
CLB2 promoter is either active or inactive.
pep4
cells (US1005) were arrested in late
G
1 phase, early S phase,
or in mitosis by treatment with

-factor, HU, or NOC, respectively.
Cell extracts from these cultures
were used in a gel mobility
shift assay with the 240-bp sequence as a
probe, and total RNA
was analyzed for the presence of the
CLB2 transcript. As expected,
the cycling extract yielded
four specific protein complexes (I,
II, III, and IV), identical to the
ones described in the preceding
paragraph (Fig.
8B, lane 2). While the
same four bands were detected
in extracts from HU-arrested cells,
complexes I, II, and III were
either absent or diminished in NOC
extracts (Fig.
8B, lanes 4
and 5). Interestingly, a slow-migrating
complex (N) was detected
in

-factor extract, which was conspicuously
absent from early-S-phase
or mitotic extracts (Fig.
8B, lane 3).
Anti-Mcm1 antibodies abolish
its formation, suggesting that this
complex also contains Mcm1
(Fig.
8B, lane 7). As expected,
CLB2 was not expressed in G
1 (

-factor
arrest), but it was efficiently transcribed in both cycling and
HU- or
NOC-arrested cells (Fig.
8B, bottom panel). Hence, the
appearance of
the slow-migrating N complex in

-factor extracts
correlates with the
absence of
CLB2 RNA. Similarly, the high-level
expression of
CLB2 in NOC-arrested extracts is concomitant with
a dramatic
reduction in the abundance of complex
III.
The
CLB2 transcription is activated in late S/G
2
phase; it continues through most of the M phase and is then switched
off
when the cells exit mitosis to enter the G
1 phase of a
new cycle
(
15,
53). Since Ndd1 is required for the
expression of
CLB2,
we wondered whether the turning off of
CLB2 transcription in G
1 is, at least in part,
caused by the absence of the Ndd1 protein.
This inquiry seemed
pertinent in light of our observation that
CLB2
transcription shuts off less efficiently in cells expressing
GAL-NDD1 (Fig.
4B and our unpublished observations). We
therefore
determined the relative stability of Ndd1 protein during the
cell
cycle.
cdc15 mutant cells carrying
GAL-HA3-NDD1 on a
CEN plasmid
(US1354) were first synchronized in late telophase by incubation
at
37°C for 2 h in raffinose medium. They were induced to express
HA
3-Ndd1 for the next 2 h by the addition of galactose
and then
allowed to resume cell cycle progression at 25°C in
galactose
medium. Constitutive expression of Ndd1 from
GAL1
promoter in
this experiment allowed us to determine not only the timing
of
its degradation but also the timing of its stabilization. Cell
extracts were prepared from samples withdrawn at various time
points
after the release and were analyzed for the presence of
both
HA3-Ndd1 and Clb2 proteins by Western blotting.
The abundance
of Ndd1 protein begins to decline 30 min after the
release from
telophase arrest, as the cells begin to disassemble the
mitotic
spindles (Fig.
8C). Ndd1 remains unstable until cells enter a
new cycle at 75 min, as indicated by the absence of anaphase spindles;
thereafter, the protein continues to accumulate until it becomes
unstable again at 180 min, when the second cycle of spindle disassembly
begins. The timing of Ndd1 degradation after the release from
telophase
arrest matched closely with that of endogenous Clb2,
but Clb2
accumulation showed an apparent delay of 40 min (Fig.
8C). This delay
is expected in this experiment since the endogenous
CLB2
gene, unlike
GAL1-driven
NDD1, is under the
control of its
native promoter and is transcribed significantly later
than is
Ndd1. Thus, the disappearance of Ndd1 protein in G
1
correlates
well with the silencing of
CLB2 transcription.
The rapid degradation of Ndd1 upon exit from mitosis also correlates
with the appearance of the slow-migrating DNA-protein
complex (N) (Fig.
8B). Therefore, we asked if the expression of
Ndd1 in G
1
would abrogate the formation of this protein complex.
pep4
cells carrying three copies of
GAL-NDD1 integrated at the
URA3 locus were first
synchronized in G
1 by

-factor treatment in raffinose
medium for 2 h. One-half of the culture was then induced to
express
NDD1 by the addition of galactose, while the other
half received
glucose to repress the
GAL1 promoter. After
2 h, cell extracts
were prepared and were used in combination with
the 240-bp promoter
fragment in a gel mobility shift assay. The
G
1 arrest induced
by

-factor was maintained through the
entire course of the experiment.
While both the slow-migrating N
complex and complex III were present
in the glucose-grown cells, their
abundance was dramatically reduced
in cells expressing Ndd1 from
GAL1 promoter (Fig.
8D, lanes 3
and 4), suggesting that Ndd1
may prevent the formation of these
protein complexes on the
CLB2 promoter. As before (Fig.
8B), the
N complex was
competed out by both the anti-Mcm1 antibodies and
a molar excess of the
nonradioactive probe (Fig.
8D, lanes 5 and
6). The overexpression of
Ndd1 also diminishes complexes I, II,
and III, suggesting that presence
of Ndd1 in G
1 also affects their
assembly.
Together, these data suggest a possible mechanism by which
NDD1 may participate in the regulation of
CLB2
expression. According
to this scheme, complexes such as N and III may
act as repressors
of
CLB2 transcription, since their
appearance is inversely correlated
to the expression of
CLB2. That Ndd1 can cause abrogation of both
complexes N and
III (Fig.
8D) implies that Ndd1 may modulate
CLB2 transcription by preventing the formation of these repressor complexes,
thereby allowing the activation of transcription. Thus, the rapid
degradation of Ndd1 in G
1, which would allow (or enhance)
the
assembly of various repressor complexes, may constitute an
important
step in the silencing of
CLB2 expression upon exit
from mitosis.
Although we describe this scheme with a particular focus
on complexes
N and III, complexes I and II could also be repressor
aggregates
of various protein compositions since, like N complex, they
are
present in protein extracts from

-factor-arrested cells and
diminish
in abundance in NOC
extracts.
A deletion analysis of Ndd1.
Based on the requirement of Ndd1
for CLB1, CLB2 and SWI5 expression and
its ability to activate transcription in a yeast one-hybrid assay, we
had raised the possibility that Ndd1 may act as an activator of
transcription. Since transcription activation in a heterologous context
such as a one-hybrid assay can be artifactual, we asked whether the
biological activity of Ndd1 (such as the suppression of
cdc28-1N and mcm1 mutations) is related to its
ability to activate transcription in a one-hybrid assay. Therefore, we
made various constructs in which the DNA-binding domain of the
GAL4 transcription factor was fused in frame with different
parts of the NDD1 ORF and then tested these constructs for
both their biological activity and their ability to activate
transcription. Such a deletion analysis was also expected to identify
the regions important for Ndd1 function.
The deletion constructs (Table
2) were
introduced into a yeast strain carrying the
lacZ reporter
under the control of
GAL4 UAS (US449), and the extent of
transcriptional activation was
estimated by quantitative measurement of
the

-galactosidase activity.
To determine the biological activity,
the hybrid fusions were
also introduced into the
ndd1
,
cdc28-1N, and
mcm1 mutants. As
evident from Table
2, the full-length
NDD1 fused to the
GAL4 DNA-binding domain is able to both activate transcription and
suppress
the growth defects of
ndd1
,
cdc28-1N, and
mcm1 mutants
(row 2). A comparison of various deletion
mutants shows that the
elimination of the C-terminal portion (residues
232 to 554; Table
2, rows 3, 4, and 5) results in a loss of the
biological activity
of Ndd1 but it does not diminish its ability to
activate transcription.
Hence, the N-terminal part of the protein is
sufficient for transcriptional
activation but not for the biological
function. Although the C-terminal
half is required for the Ndd1
function, by itself it is both biologically
and transcriptionally
inactive (row 9). Interestingly, the polyglutamine
stretch in the
N-terminal half, the most conspicuous feature of
the protein, is
dispensable since its deletion does not affect
Ndd1 function, although
it does elicit a higher level of transcription
activation (row 12).
These results imply that the ability of Ndd1
to activate transcription
in a one-hybrid assay may be unrelated
to its biological function.
However, it is possible that Ndd1
serves as a transcription activator
in other cellular contexts.
 |
DISCUSSION |
The activities of many of the cell cycle effectors are regulated
by protein modification, as well as by the controls operating at the
level of transcription. Such multitiered regulation is presumably
necessary in order to sharpen the timing of various cellular events
during the progression through the division cycle. The
cis-acting DNA sequences and the factors that activate the transcription of genes at START or at the onset of the S phase have
been described in some detail (23, 28, 37, 38). However, the
transcriptional regulation of the late S/G2-phase-specific genes is poorly understood. So far, Mcm1 and another putative transcription factor, Sff, have been shown to participate in the control of gene expression at this stage of the cell cycle (1, 29). However, since Mcm1 is also required for the regulation of a
number of other genes whose transcription is not periodic (31, 33,
51), it is unlikely that Mcm1 itself is the major target for cell
cycle regulation. This notion is consistent with the finding that Mcm1
occupies both SWI5 and CLB2 promoters at all
times, although their expression is cyclic (1).
We have identified and characterized a new gene, NDD1, that
plays an essential role in the expression of the late-S-phase genes
CLB1, CLB2, and SWI5, such that none
of these genes are transcribed in its absence. Thus, it is a new player
in the regulation of gene expression during late S phase. Ndd1 is not
only essential for the transcription of CLB1 and
CLB2, but its excess enhances the level of their expression.
This observation may provide an explanation for the ability of Ndd1 to
suppress the cdc28-1N mutation. The requirement of
NDD1 for CLB1 and CLB2 expression may
argue that the lethality of the ndd1
mutant is solely due
to a lack of these mitotic cyclins. However, overexpression of
CLB2 from the GAL1 promoter fails to suppress the
nuclear-division defect of NDD1-deficient cells (Fig. 5B),
implying that NDD1 is necessary for the expression of
additional genes that participate in the process of nuclear division.
NDD1 was also independently identified as a gene whose
overexpression could suppress a crippling mutation in the
SWI5 UAS, which abolishes SWI5 transcription
(29a).
NDD1 is expressed in a cell-cycle-stage-dependent manner
such that its expression peaks in S phase just prior to the expression of its target gene CLB2 (Fig. 3A). This may implicate
NDD1 as a critical factor in the timing of CLB2
expression. Our observation that the constitutive expression of Ndd1
does not alter the cell-cycle-regulated pattern of CLB2
transcription (Fig. 4B) suggests that NDD1, though necessary
for the activation of a subset of late-S-phase genes, is not a crucial
determinant in the temporal control of their transcription. However,
since the constitutive expression of Ndd1 leads to inefficient
silencing of CLB2 transcription in late telophase (unpublished observations), the turning off of CLB2
transcription in late telophase may involve regulation of the Ndd1
protein. It is conceivable that the inactivation of the Ndd1 protein
might be one of the steps required to switch off CLB2
expression at the end of mitosis. The instability of Ndd1 due to rapid
degradation during mitotic exit is consistent with this notion (Fig.
8C). The mechanism, which renders Ndd1 unstable in G1,
remains unclear. We found four destruction-box-like sequences in the
middle region of the protein, but their removal did not affect its
stability (unpublished results). Another important factor in silencing
CLB2 expression may be the Cdc28-Clb kinase itself. It has
been previously shown that Cdc28-Clb kinase complex stimulates
CLB2 expression via a positive feedback loop (4).
Consequently, inactivation of the kinase by abrupt proteolysis of Clb
proteins during the M/G1 transition could lead to a rapid
decline in CLB2 expression.
The genetic interaction with MCM1 and its ability to enhance
CLB1, CLB2, and SWI5 transcription
lead us to suspect that NDD1 may influence gene expression
by modulating their promoter activity. During the course of our
studies, we discovered that the previously reported 55-bp UAS
(30) in the CLB2 promoter, which contains a pair
of regulatory sites comprised of one MCE and one SFRE, is unable to
drive the expression of a reporter gene in our assay system (see
Materials and Methods). In an identical assay, the 55-bp UAS of
SWI5 gene not only elicited transcription but also showed
the expected pattern of expression during the cell cycle. This suggests
that the inactivity of the 55-bp CLB2 UAS in our experiments
is not due to a faulty assay system. By further investigations, we have
identified a 240-bp fragment that is sufficient for both the expression
and the cell cycle regulation of CLB2. The 240-bp sequence
contains within it the 55-bp presumptive UAS and another pair of MCE
and SFRE flanked by two additional MCE (Fig. 6A) (reference 1 and this study). This configuration is also
capable of mediating the transcriptional enhancement caused by the
overexpression of Ndd1; the 55-bp UAS alone, on the other hand, remains
unresponsive (Fig. 7). The CLB1 promoter also harbors two
pairs of MCE and SFRE but their spatial arrangement is not identical to
that in the CLB2 promoter (1). It is intriguing
that while one set of MCE and SFRE can appropriately regulate
SWI5 expression, it is not sufficient for the activation of
CLB2 transcription. Perhaps this is due to the differences
in both the regulatory sequences themselves and in the promoter
sequence within which these elements are embedded.
The 240-bp promoter fragment promotes the assembly of four prominent
protein complexes. While the exact composition of these complexes
remains unknown, they all appear to contain Mcm1 (Fig. 8A). Extracts
prepared from cells traversing synchronously through the cell cycle are
capable of assembling, albeit to various extents, all four complexes on
this CLB2 promoter fragment (data not shown). Interestingly,
Ndd1 is not recruited to any of these protein complexes, as is
suggested by the gel mobility shift assay (Fig. 8A), despite its
requirement for CLB1, CLB2, and SWI5
transcription and its ability to enhance gene expression. In
immunoprecipitation experiments, Ndd1 neither associates with Mcm1 nor
with any of the major components of the general transcription machinery
such as yeast TBP, TAF145, or TAF90
(unpublished data). These observations suggest that Ndd1 cooperates
indirectly with the transcriptional apparatus, possibly through
intermediary proteins, to regulate the expression of late-S-phase genes. How then, does Ndd1 exert its effect on gene expression? One
possibility is that Ndd1 is an effector of Cdc28-Clb kinase activity
and that it affects CLB2 transcription by modifying the efficacy of the positive-feedback loop. However, this seems unlikely, because the Ndd1-depleted cells during NOC-induced arrest contain significant levels of the mitotic kinase activity but yet do not transcribe CLB2 (unpublished results).
Alternatively, Ndd1 may prevent a repressor from binding to the
CLB2 promoter, thus allowing the activation of
transcription. The finding that Mcm1, an activator of transcription,
occupies the CLB2 promoter throughout the cell cycle
(1) strengthens the possibility that a repressor may be, in
part, responsible for the termination of CLB2 transcription
in G1. In the context of Ndd1 function, this repressor
model is consistent with some of our findings: (i) a new protein
complex N is detected on the 240-bp promoter fragment during
G1 when CLB2 transcription is abruptly switched
off; (ii) this complex is undetectable in HU- or NOC-arrested cells
where CLB2 is actively transcribed; (iii) overexpression of
Ndd1 in G1 abolishes the formation of the N complex; and
(iv) in wild-type cells, Ndd1 is rapidly degraded in G1,
concomitant with the silencing of CLB2 expression. Complex III behaves like complex N in that its abundance is enhanced during G1, dramatically reduced during NOC-induced arrest when
CLB2 is maximally transcribed, and negatively influenced by
the overexpression of Ndd1. Thus, complexes N and III could be
repressor assemblages capable of terminating CLB2
expression. Although the presence of Ndd1 abolishes the formation of
the presumptive repressor complexes, its overexpression does not elicit
CLB2 expression in G1. This implies that a lack
of Ndd1 protein may not be the sole reason for the termination of
CLB2 transcription; a progressive weakening of the
positive-feedback loop upon proteolysis of Clb proteins may also be
critical. The nature of the hypothetical repressor is so far unknown.
To identify such a repressor, we have embarked upon a genetic screen to
isolate mutations that will lead to inappropriate CLB2
expression in G1.
With the identification of NDD1, we have added a new element
in the regulation of gene expression in late S phase. However, further
investigations will be required to uncover the mechanism that ensures
the correct timing of the onset and termination of the expression of
these genes.
 |
ACKNOWLEDGMENTS |
We thank Kim Nasmyth, in whose laboratory the plasmid containing
NDD1 was first isolated by U.S. We are grateful to Gustav Ammerer for various strains, anti-Mcm1 antibodies, suggestions, and
fruitful discussions.
This work was supported by the National Science and Technology Board, Singapore.
 |
FOOTNOTES |
*
Corresponding author. Mailing address: Institute of
Molecular and Cell Biology, 30, Medical Dr., Singapore 117609, Singapore. Phone: (65) 7743612. Fax: (65) 7791117. E-mail:
mcbucs{at}imcb.nus.edu.sg.
 |
REFERENCES |
| 1.
|
Althoefer, H.,
A. Schleiffer,
K. Wassmann,
A. Nordheim, and G. Ammerer.
1995.
Mcm1 is required to coordinate G2-specific transcription in Saccharomyces cerevisiae.
Mol. Cell. Biol.
15:5917-5928[Abstract].
|
| 1a.
| Ammerer, G. Personal communication.
|
| 2.
|
Amon, A.
1997.
Regulation of B-type cyclin proteolysis by Cdc28-associated kinase in budding yeast.
EMBO J.
16:2693-2702[Medline].
|
| 3.
|
Amon, A.,
S. Irniger, and K. Nasmyth.
1994.
Closing the cell cycle circle in yeast: G2 cyclin proteolysis initiated at mitosis persists until the activation of G1 cyclins in the next cell cycle.
Cell
77:1037-1050[Medline].
|
| 4.
|
Amon, A.,
M. Tyers,
B. Futcher, and K. Nasmyth.
1993.
Mechanisms that help the yeast cell cycle clock tick: G2 cyclins transcriptionally activate G2 cyclins and repress G1 cyclins.
Cell
74:993-1007[Medline].
|
| 5.
|
Amon, A.,
U. Surana,
I. Muroff, and K. Nasmyth.
1992.
Regulation of p34CDC28 tyrosine phosphorylation is not required for entry into mitosis in S. cerevisiae.
Nature (London)
355:368-371[Medline].
|
| 6.
|
Andrews, B. J., and I. Herskowitz.
1989.
Identification of a DNA binding factor involved in cell-cycle control of the yeast HO gene.
Cell
57:21-29[Medline].
|
| 7.
|
Ausubel, F. A.,
R. Brent,
R. E. Kingston,
D. D. Moore,
J. G. Seidman,
J. A. Smith, and K. Struhl (ed.).
1998.
Current protocols in molecular biology.
John Wiley & Sons, New York, N.Y.
|
| 8.
|
Bachmair, A.,
D. Finley, and A. Varshavsky.
1986.
In vivo half-life of a protein is a function of its amino-terminal residue.
Science
234:179-186[Abstract/Free Full Text].
|
| 9.
|
Bartel, P.,
C. T. Chien,
R. Sternglanz, and S. Fields.
1993.
Elimination of false positives that arise in using the two-hybrid system.
BioTechniques
14:920-924[Medline].
|
| 10.
|
Blondel, M., and C. Mann.
1996.
G2 cyclins are required for the degradation of G1 cyclins in yeast.
Nature (London)
384:279-282[Medline].
|
| 11.
|
Breeden, L., and K. Nasmyth.
1987.
Cell cycle control of the yeast HO gene: cis and trans-acting regulators.
Cell
48:389-397[Medline].
|
| 12.
|
Company, M.,
C. Adler, and B. Errede.
1988.
Identification of a Ty1 regulatory sequence responsive to STE7 and STE12.
Mol. Cell. Biol.
8:2545-2554[Abstract/Free Full Text].
|
| 13.
|
Cross, F., and A. H. Tinkelenberg.
1991.
A positive feedback loop controlling CLN1 and CLN2 gene expression at the START of yeast cell cycle.
Cell
65:875-883[Medline].
|
| 14.
|
Epstein, C. B., and F. Cross.
1992.
CLB5: a novel B type cyclin from yeast with a role in S-phase.
Genes Dev.
6:1695-1706[Abstract/Free Full Text].
|
| 15.
|
Fitch, I.,
C. Dahman,
U. Surana,
A. Amon,
L. Goetsh,
B. Byers, and B. Futcher.
1992.
Characterization of four B-type cyclin genes of the budding yeast S. cerevisiae.
Mol. Biol. Cell
3:805-818[Abstract].
|
| 16.
|
Ghiara, J. B.,
H. E. Richardson,
K. Sugimoto,
M. Henze,
D. J. Lew,
C. Wittenberg, and S. I. Reed.
1991.
A cyclin B homolog in S. cerevisiae. Chronic activation of the Cdc28 protein kinase by cyclin prevents exit from mitosis.
Cell
65:163-174[Medline].
|
| 17.
|
Ghislain, M.,
A. Udvardy, and C. Mann.
1993.
S. cerevisiae 26S protease mutants arrest cell division in G2/metaphase.
Nature (London)
366:358-362[Medline].
|
| 18.
|
Glotzer, M.,
A. W. Murray, and M. W. Kirshner.
1991.
Cyclin is degraded by the ubiquitin pathway.
Nature (London)
349:132-138[Medline].
|
| 19.
|
Gu, Y.,
J. Rosenblatt, and D. O. Morgan.
1992.
Cell cycle regulation of CDK2 activity by phosphorylation of Thr160 and Tyr15.
EMBO J.
11:3995-4005[Medline].
|
| 20.
|
Hartwell, L. H.,
J. R. Culotti, and B. J. Reid.
1974.
Genetic control of the cell cycle in yeast.
Science
183:46-51[Free Full Text].
|
| 21.
|
Kilmartin, J. V., and A. E. M. Adams.
1984.
Structural arrangements of tubulin and actin during the cell cycle of yeast Saccharomyces cerevisiae.
J. Cell Biol.
98:922-933[Abstract/Free Full Text].
|
| 22.
|
Koch, C., and K. Nasmyth.
1994.
Cell cycle regulated transcription in yeast.
Curr. Opin. Cell Biol.
6:451-459[Medline].
|
| 23.
|
Koch, C.,
T. Moll,
M. Neuberg,
H. Ahorn, and K. Nasmyth.
1993.
A role for the transcription factors Mbp1 and Swi4 in progression from G1 to S phase.
Science
261:1551-1557[Abstract/Free Full Text].
|
| 24.
|
Kotani, S.,
S. Tugendreich,
M. Fujii,
P. M. Jorgensen,
N. Watanabe,
C. Hoog,
P. Hieter, and K. Todokoro.
1998.
PKA and MPF-activated polo-like kinase regulate anaphase-promoting complex activity and mitosis progression.
Mol. Cell
1:371-380[Medline].
|
| 25.
|
Kuo, M.-H., and E. J. Grayhack.
1994.
A library of yeast genomic Mcm1 binding sites contains genes involved in cell cycle control, cell wall and membrane structure, and metabolism.
Mol. Cell. Biol.
14:348-359[Abstract/Free Full Text].
|
| 26.
|
Kuo, M.-H.,
E. T. Nadeau, and E. J. Grayhack.
1997.
Multiple phosphorylated forms of the Saccharomyces cerevisiae Mcm1 protein include an isoform induced in response to high salt concentrations.
Mol. Cell. Biol.
17:819-832[Abstract].
|
| 27.
|
Lim, H. H.,
C. J. Loy,
S. Zaman, and U. Surana.
1996.
Dephosphorylation of threonine 169 of Cdc28 is not required for the exit from mitosis but may be necessary for START in Saccharomyces cerevisiae.
Mol. Cell. Biol.
16:4573-4583[Abstract].
|
| 28.
|
Lowndes, N. F.,
A. L. Johnson,
L. Breeden, and L. H. Johnston.
1992.
Swi6 protein is required for transcription of the periodically expressed DNA synthesis genes in budding yeast.
Nature (London)
357:505-508[Medline].
|
| 29.
|
Lydall, D.,
G. Ammerer, and K. Nasmyth.
1991.
A new role for MCM1 in yeast: cell cycle regulation of SWI5 transcription.
Genes Dev.
5:2405-2419[Abstract/Free Full Text].
|
| 29a.
| Lydall, D., and K. Nasmyth. Unpublished results.
|
| 30.
|
Maher, M.,
F. Cong,
D. Kindelberger,
K. Nasmyth, and S. Dalton.
1995.
Cell cycle-regulated transcription of the CLB2 gene is dependent on Mcm1 and a ternary complex factor.
Mol. Cell. Biol.
15:3129-3137[Abstract].
|
| 31.
|
Maine, G.,
P. Sinha, and B.-K. Tye.
1984.
Mutants of S. cerevisiae defective in the maintenance of minichromosomes.
Genetics
106:365-385[Abstract/Free Full Text].
|
| 32.
|
McInerny, C. J.,
J. F. Partridge,
G. E. Mikesell,
D. P. Creemer, and L. L. Breeden.
1997.
A novel Mcm1-dependent element in the SWI4, CLN3, CDC6, and CDC47 promoters activates M/G1-specific transcription.
Genes Dev.
11:1277-1288[Abstract/Free Full Text].
|
| 33.
|
Messenguy, F., and E. Dubois.
1993.
Genetic evidence for a role for MCM1 in the regulation of arginine metabolism in Saccharomyces cerevisiae.
Mol. Cell. Biol.
13:2586-2592[Abstract/Free Full Text].
|
| 34.
|
Morgan, D. O.
1995.
Principles of CDK regulation.
Nature (London)
374:131-134[Medline].
|
| 35.
|
Nasmyth, K.
1993.
Control of the yeast cell cycle by the Cdc28 protein kinase.
Curr. Opin. Cell Biol.
5:166-179[Medline].
|
| 36.
|
Nasmyth, K., and K. Tatchell.
1980.
The structure of transposable yeast mating type loci.
Cell
19:753-764[Medline].
|
| 37.
|
Nasmyth, K., and L. Dirick.
1991.
The role of SWI4 and SWI6 in the activity of G1 cyclins in yeast.
Cell
66:995-1013[Medline].
|
| 37a.
| O'Connor, M. Personal communication.
|
| 38.
|
Ogas, J.,
B. J. Andrews, and I. Herskowitz.
1991.
Transcriptional activation of CLN1, CLN2, and a putative new G1 cyclin (HCS26) by SWI4, a positive regulator of G1-specific transcription.
Cell
66:1015-1026[Medline].
|
| 39.
|
Piggot, J. R.,
R. Rai, and B. L. A. Carter.
1982.
A bifunctional gene product involved in two phases of the yeast cell cycle.
Nature (London)
298:391-393[Medline].
|
| 40.
|
Price, C.,
K. Nasmyth, and T. Schuster.
1991.
A general approach to the isolation of cell cycle-regulated genes in the budding yeast Saccharomyces cerevisiae.
J. Cell Biol.
218:543-556.
|
| 41.
|
Reed, S. I., and C. Wittenberg.
1990.
Mitotic role for the Cdc28 protein kinase of S. cerevisiae.
Proc. Natl. Acad. Sci. USA
87:5697-5701[Abstract/Free Full Text].
|
| 42.
|
Reed, S. I.,
J. A. Hadwiger, and A. Lorincz.
1985.
Protein kinase activity associated with the product of the yeast cell division cycle gene CDC28.
Proc. Natl. Acad. Sci. USA
82:4055-4059[Abstract/Free Full Text].
|
| 43.
|
Richardson, H. E.,
C. Wittenberg,
F. Cross, and S. Reed.
1989.
An essential G1 function for cyclin-like proteins in yeast.
Cell
59:1127-1133[Medline].
|
| 44.
|
Rose, M. D.,
F. Winston, and P. Hieter.
1990.
Methods in yeast genetics: a laboratory course manual.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 45.
|
Rothstein, R.
1991.
Targeting, disruption, replacement, and allele rescue: integrative DNA transformation in yeast.
Methods Enzymol.
194:281-301[Medline].
|
| 46.
|
Sambrook, J.,
E. F. Fritsch, and T. Maniatis.
1989.
Molecular cloning: a laboratory manual, 2nd ed.
Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.
|
| 47.
|
Schneider, B. L.,
E. E. Patton,
S. Lanker,
M. D. Mendenhall,
C. Wittenberg,
B. Futcher, and M. Tyers.
1998.
Yeast G1 cyclins are unstable in G1 phase.
Nature (London)
395:86-89[Medline].
|
| 48.
|
Schwob, E., and K. Nasmyth.
1993.
CLB5 and CLB6, a new pair of B cyclins involved in S phase and mitotic spindle formation in S. cerevisiae.
Genes Dev.
7:1160-1175[Abstract/Free Full Text].
|
| 49.
|
Sorger, P. K., and A. W. Murray.
1992.
S-phase feedback control in budding yeast is independent of tyrosine phosphorylation of p34CDC28.
Nature (London)
355:365-368[Medline].
|
| 50.
|
Spellman, P. T.,
G. Sherlock,
M. Q. Zhang,
V. R. Iyer,
K. Anders,
M. B. Eisen,
P. O. Brown,
D. Botstein, and B. Futcher.
1998.
Comprehensive identification of cell cycle-regulated genes of the yeast Saccharomyces cerevisiae by microarray hybridization.
Mol. Biol. Cell
9:3273-3297[Abstract/Free Full Text].
|
| 51.
|
Sprague, G.
1990.
Combinatorial associations of regulatory proteins and the control of cell type in yeast.
Adv. Genet.
27:33-62[Medline].
|
| 52.
|
Surana, U.,
A. Amon,
G. Dowzer,
J. McGrew,
B. Byers, and K. Nasmyth.
1993.
Destruction of the CDC28/CLB mitotic kinase is not required for the metaphase to anaphase transition in budding yeast.
EMBO J.
12:1969-1978[Medline].
|
| 53.
|
Surana, U.,
H. Robitsch,
C. Price,
T. Schuster,
I. Fitch,
A. B. Futcher, and K. Nasmyth.
1991.
The role of CDC28 and cyclins during mitosis in the budding yeast S. cerevisiae.
Cell
65:145-161[Medline].
|
| 54.
|
Townsley, F. M., and J. V. Ruderman.
1998.
Proteolytic ratchets that control progression through mitosis.
Trends Cell Biol.
8:238-244.
[Medline] |
| 55.
|
Wolf, D. A., and P. K. Jackson.
1998.
Cell cycle: oiling the gears of anaphase.
Curr. Biol.
8:636-639.
|
Molecular and Cellular Biology, May 1999, p. 3312-3327, Vol. 19, No. 5
0270-7306/99/$04.00+0
Copyright © 1999, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Pondugula, S., Neef, D. W., Voth, W. P., Darst, R. P., Dhasarathy, A., Reynolds, M. M., Takahata, S., Stillman, D. J., Kladde, M. P.
(2009). Coupling Phosphate Homeostasis to Cell Cycle-Specific Transcription: Mitotic Activation of Saccharomyces cerevisiae PHO5 by Mcm1 and Forkhead Proteins. Mol. Cell. Biol.
29: 4891-4905
[Abstract]
[Full Text]
-
Kishi, T., Ikeda, A., Koyama, N., Fukada, J., Nagao, R.
(2008). A refined two-hybrid system reveals that SCFCdc4-dependent degradation of Swi5 contributes to the regulatory mechanism of S-phase entry. Proc. Natl. Acad. Sci. USA
105: 14497-14502
[Abstract]
[Full Text]
-
Papadopoulou, K., Ng, S. S., Ohkura, H., Geymonat, M., Sedgwick, S. G., McInerny, C. J.
(2008). Regulation of gene expression during M-G1-phase in fission yeast through Plo1p and forkhead transcription factors. J. Cell Sci.
121: 38-47
[Abstract]
[Full Text]
-
Veis, J., Klug, H., Koranda, M., Ammerer, G.
(2007). Activation of the G2/M-Specific Gene CLB2 Requires Multiple Cell Cycle Signals. Mol. Cell. Biol.
27: 8364-8373
[Abstract]
[Full Text]
-
Sherriff, J. A., Kent, N. A., Mellor, J.
(2007). The Isw2 Chromatin-Remodeling ATPase Cooperates with the Fkh2 Transcription Factor To Repress Transcription of the B-Type Cyclin Gene CLB2. Mol. Cell. Biol.
27: 2848-2860
[Abstract]
[Full Text]
-
Morris, E. R., Chevalier, D., Walker, J. C.
(2006). DAWDLE, a Forkhead-Associated Domain Gene, Regulates Multiple Aspects of Plant Development. Plant Physiol.
141: 932-941
[Abstract]
[Full Text]
-
Yu, X., Lin, J., Masuda, T., Esumi, N., Zack, D. J., Qian, J.
(2006). Genome-wide prediction and characterization of interactions between transcription factors in Saccharomyces cerevisiae. Nucleic Acids Res
34: 917-927
[Abstract]
[Full Text]
-
Nagamine, N., Kawada, Y., Sakakibara, Y.
(2005). Identifying cooperative transcriptional regulations using protein-protein interactions. Nucleic Acids Res
33: 4828-4837
[Abstract]
[Full Text]
-
Bulashevska, S., Eils, R.
(2005). Inferring genetic regulatory logic from expression data. Bioinformatics
21: 2706-2713
[Abstract]
[Full Text]
-
Pic-Taylor, A., Darieva, Z., Morgan, B. A., Sharrocks, A. D.
(2004). Regulation of Cell Cycle-Specific Gene Expression through Cyclin-Dependent Kinase-Mediated Phosphorylation of the Forkhead Transcription Factor Fkh2p. Mol. Cell. Biol.
24: 10036-10046
[Abstract]
[Full Text]
-
Buck, V., Ng, S. S., Ruiz-Garcia, A. B., Papadopoulou, K., Bhatti, S., Samuel, J. M., Anderson, M., Millar, J. B. A., McInerny, C. J.
(2004). Fkh2p and Sep1p regulate mitotic gene transcription in fission yeast. J. Cell Sci.
117: 5623-5632
[Abstract]
[Full Text]
-
Banerjee, N., Zhang, M. Q.
(2003). Identifying cooperativity among transcription factors controlling the cell cycle in yeast. Nucleic Acids Res
31: 7024-7031
[Abstract]
[Full Text]
-
Van Slyke, C., Grayhack, E. J.
(2003). The essential transcription factor Reb1p interacts with the CLB2 UAS outside of the G2/M control region. Nucleic Acids Res
31: 4597-4607
[Abstract]
[Full Text]
-
Reynolds, D., Shi, B. J., McLean, C., Katsis, F., Kemp, B., Dalton, S.
(2003). Recruitment of Thr 319-phosphorylated Ndd1p to the FHA domain of Fkh2p requires Clbkinase activity: a mechanism for CLB cluster gene activation. Genes Dev.
17: 1789-1802
[Abstract]
[Full Text]
-
Boros, J., Lim, F.-L., Darieva, Z., Pic-Taylor, A., Harman, R., Morgan, B. A., Sharrocks, A. D.
(2003). Molecular determinants of the cell-cycle regulated Mcm1p-Fkh2p transcription factor complex. Nucleic Acids Res
31: 2279-2288
[Abstract]
[Full Text]
-
Sun, K., Coic, E., Zhou, Z., Durrens, P., Haber, J. E.
(2002). Saccharomyces forkhead protein Fkh1 regulates donor preference during mating-type switching through the recombination enhancer. Genes Dev.
16: 2085-2096
[Abstract]
[Full Text]
-
Mai, B., Miles, S., Breeden, L. L.
(2002). Characterization of the ECB Binding Complex Responsible for the M/G1-Specific Transcription of CLN3 and SWI4. Mol. Cell. Biol.
22: 430-441
[Abstract]
[Full Text]
-
Magnard, J.-L., Yang, M., Chen, Y.-C. S., Leary, M., McCormick, S.
(2001). The Arabidopsis Gene Tardy Asynchronous Meiosis Is Required for the Normal Pace and Synchrony of Cell Division during Male Meiosis. Plant Physiol.
127: 1157-1166
[Abstract]
[Full Text]