Previous Article | Next Article 
Molecular and Cellular Biology, August 2000, p. 6159-6169, Vol. 20, No. 16
0270-7306/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
BCR-ABL Prevents c-Jun-Mediated and Proteasome-Dependent FUS
(TLS) Proteolysis through a Protein Kinase C
II-Dependent
Pathway
Danilo
Perrotti,1,*
Angela
Iervolino,1
Vincenzo
Cesi,1
Maria
Cirinná,1
Silvia
Lombardini,2
Emanuela
Grassilli,1
Silvia
Bonatti,2
Pier Paolo
Claudio,1 and
Bruno
Calabretta1,2,*
Department of Microbiology and Immunology,
Kimmel Cancer Center, Thomas Jefferson University, Philadelphia,
Pennsylvania 19107,1 and Department of
Biomedical Sciences, Section of General Pathology, University of
Modena, Modena, Italy2
Received 20 January 2000/Returned for modification 17 March
2000/Accepted 8 May 2000
 |
ABSTRACT |
The DNA binding activity of FUS (also known as TLS), a nuclear
pro-oncogene involved in multiple translocations, is regulated by
BCR-ABL in a protein kinase C
II (PKC
II)-dependent manner. We show
here that in normal myeloid progenitor cells FUS, although not visibly
ubiquitinated, undergoes proteasome-dependent degradation, whereas in
BCR-ABL-expressing cells, degradation is suppressed by PKC
II
phosphorylation. Replacement of serine 256 with the phosphomimetic
aspartic acid prevents proteasome-dependent proteolysis of FUS, while
the serine-256-to-alanine FUS mutant is unstable and susceptible to
degradation. Ectopic expression of the phosphomimetic S256D FUS mutant
in granulocyte colony-stimulating factor-treated 32Dcl3 cells induces
massive apoptosis and inhibits the differentiation of the cells
escaping cell death, while the degradation-prone S256A mutant has no
effect on either survival or differentiation. FUS proteolysis is
induced by c-Jun, is suppressed by BCR-ABL or Jun kinase 1, and
does not depend on c-Jun transactivation potential, ubiquitination, or
its interaction with Jun kinase 1. In addition, c-Jun-induced FUS
proteasome-dependent degradation is enhanced by heterogeneous nuclear
ribonucleoprotein (hnRNP) A1 and depends on the formation of a
FUS-Jun-hnRNP A1-containing complex and on lack of PKC
II
phosphorylation at serine 256 but not on FUS ubiquitination. Thus,
novel mechanisms appear to be involved in the degradation of FUS in
normal myeloid cells; moreover, the ability of the BCR-ABL oncoprotein
to suppress FUS degradation by the induction of posttranslational
modifications might contribute to the phenotype of BCR-ABL-expressing
hematopoietic cells.
 |
INTRODUCTION |
FUS, also known as TLS or
heterogeneous nuclear ribonucleoprotein (hnRNP) P2, was first
discovered as the N-terminal part of a fusion with CHOP in myxoid
liposarcoma carrying the t(12;16) translocation (8, 33) and
was subsequently detected in different types of human myeloid leukemia
(37), in which the C terminus of FUS is replaced by the
DNA-binding domain of ERG (28). The C terminus of FUS is
required for binding to pre-mRNA and mRNA, while the N terminus appears
to function as a transcription activation domain (34). FUS
is expressed at high levels in hematopoietic and nonhematopoietic
tissues and is localized primarily in the nucleus, where it might be
involved in pre-mRNA processing and nucleocytoplasmic shuttling, as
well as in the regulation of basal transcription (35). FUS
expression and DNA binding activity is induced in hematopoietic cells
by BCR-ABL (30), which circumvents signals generated by the
interaction of growth factors (e.g., interleukin-3 [IL-3]) with their
receptors (43). The DNA binding activity of FUS
requires protein kinase C
II (PKC
II)-dependent phosphorylation, as indicated by use of PKC
II-specific
inhibitors and expression of a dominant-negative PKC
II mutant
(30). Suppression of FUS expression in myeloid precursor
cells accelerates granulocyte colony-stimulating factor
(G-CSF)-stimulated differentiation and is accompanied by
upregulation of G-CSF receptor expression (30). By
contrast, downregulation of FUS expression in BCR-ABL-expressing cells
is associated with suppression of growth factor-independent colony
formation, partial restoration of G-CSF-induced granulocytic differentiation, and reduced tumorigenic potential in vivo
(30).
The ability of BCR-ABL oncoproteins to transform hematopoietic cells
depends on their tyrosine kinase activity (23), which is
essential for recruiting and activating multiple biochemical pathways
that transduce oncogenic signals (7), positively or negatively regulating the activity of nuclear effectors. The
BCR-ABL-dependent activation of nuclear regulators might be due to
mechanisms of enhanced transcription, as reported for c-myc
(36, 41), but might also involve posttranslational
modifications that increase the stability or induce the proteolytic
degradation of target substrates. Indeed, BCR-ABL promotes the
ubiquitin- and proteasome-dependent degradation of antioncogenic Abi
proteins (10).
Oncogenic ABL proteins regulate the activity of many downstream
effectors directly or via a cascade of phosphorylation and dephosphorylation events (43). These processes control the
formation of multiprotein complexes which appear to be required for
transducing oncogenic signals and, perhaps, for regulating the
stability of some ABL effectors. Indeed, phosphorylation plays a key
role in controlling the function of regulatory proteins by targeting
them to the ubiquitin-proteasome proteolytic machinery (13).
In mammalian cells, the 26S proteasome is a specialized multisubunit
enzyme with different catalytic activities (22). It is the
predominant intracellular, nuclear, and cytoplasmic (3) nonlysosomal proteolytic mechanism involved in the regulation of a
broad range of processes, such as cell cycle progression, antigen
presentation, and gene expression (6). This degradation pathway involves an enzymatic cascade through which multiple ubiquitin molecules are covalently ligated to the protein substrate, which is
then degraded by the 26S proteasome complex (6).
Beside polyubiquitinated substrates, the proteasome is also responsible
for the degradation of proteins which, like ornithine decarboxylase
(ODC), do not undergo ubiquitination (1, 31).
In this study, we show that FUS is degraded by a proteasome-dependent
process in which the targeting of FUS to the proteasome is dependent on
the formation of a complex with c-Jun and hnRNP A1 but not on FUS
ubiquitination. In BCR-ABL-expressing cells, the enhanced FUS
expression requires PKC
II phosphorylation of serine 256, which
prevents proteasome-mediated FUS degradation. In parental 32Dcl3 cells
treated with G-CSF, ectopic expression of the degradation-resistant
serine-to-aspartic acid phosphomimetic FUS mutant induces massive
apoptosis and the emergence of a cohort of differentiation-arrested
cells able to grow in the presence of G-CSF.
 |
MATERIALS AND METHODS |
Cell cultures.
The murine IL-3-dependent 32Dcl3 myeloid
precursor and its derivative cell lines were maintained in culture or
induced to differentiate as described previously (30).
Morphologic differentiation was monitored by May-Grunwald and Giemsa
staining of cytospin preparations. For assays requiring cell
starvation, cells were washed four times in phosphate-buffered saline
(PBS) and incubated for 8 to 12 h in RPMI supplemented with 10%
fetal bovine serum or 0.1% bovine serum albumin and 2 mM
L-glutamine, as indicated. The 293T human embryonic kidney
cell line transformed with the adenovirus 5 DNA (American Type Culture
Collection, Rockville, Md.) was maintained in Dulbecco's modified
Eagle's medium supplemented with 10% heat-inactivated fetal calf
serum and 2 mM glutamine (Gibco). BOSC 23 packaging cells (American
Type Culture Collection) were cultured and transfected as described
previously (29). The 32DBCR-ABL cell line has been described
previously (30).
Transfection and retroviral infection.
32Dcl3 and
32DBCR-ABL-derived cell lines were generated by electroporation
(GenPulser; Bio-Rad) at 200 mV and 960 µF with the following
retroviral constructs: LXSP-HA-FUS (32D-WTFUS and 32DBCR-ABL-WTFUS), LXSP-HA-S256AFUS (32D-S256AFUS and
32DBCR-ABL-S256AFUS), and LXSP-HA-S256DFUS (32D-S256DFUS). Mixed
populations and single-cell clones, obtained after puromycin (2 µg/ml) selection, were maintained in culture as described previously
(30). 32Dcl3 and 32DBCR-ABL cells transfected with the empty
vector LXSP were morphologically identical to the parental cells.
Retroviral infection of parental and BCR-ABL-expressing 32Dcl3 cells
was carried out as described previously (29). For transient
transfection, 293T cells were grown for 16 to 18 h to 80%
confluence and transfected with 30 µg of plasmid DNA by calcium
phosphate precipitation using the ProFection system (Promega). The
empty pMT plasmid was used to normalize for equal amounts of
transfected DNA.
Plasmids. (i) LXSP-HA WT FUS.
A SpeI DNA fragment
encoding the hemagglutinin (HA) epitope was subcloned in frame in front
of the FUS translation start site after SpeI restriction
digestion of plasmid pBS-FUS (30). The resulting plasmid,
pSK-HA-FUS, was digested with HindIII and
XbaI, Klenow blunt ended, and subcloned in the sense
orientation into the blunted EcoRI site of the LXSP
retroviral vector.
(ii) LXSP-HA S256A FUS and LXSP-HA S256D FUS.
Primers
containing the mutation of FUS serine 256 to alanine or aspartic acid
were used to mutagenize FUS (Quickeasy mutagenesis kit; Stratagene)
with plasmid pSK-HA-FUS as template. Plasmids pSK-HA S256A FUS and
pSK-HA S256D FUS were XbaI-HindIII digested, blunted, and subcloned into the blunted EcoRI site of the
LXSP retroviral vector.
(iii) pMT-HA WT FUS.
The XbaI
blunted-HindIII fragment from pSK-HA-FUS containing the
HA-tagged FUS full-length cDNA was subcloned in the sense orientation
into the cytomegalovirus (CMV)-based pMT expression vector
(40) previously digested with BamHI, blunted, and
digested with HindIII.
(iv) pMT-AZ (antizyme).
The XbaI
blunted-HindIII fragment from plasmid ZZ5
(24) containing the full-length antizyme rat cDNA was
subcloned in sense orientation into the CMV-based expression vector pMT
previously digested with BamHI, blunted, and redigested with
HindIII.
(v) pMT-HA-cMyb.
The HA-tagged human c-myb cDNA
was subcloned in sense orientation into the CMV-based vector pMT.
(vi) pMT-HA-hnRNP A1.
The full-length hnRNP A1 cDNA (kind
gift of G. Dreyfuss, Howard Hughes Medical Institute, University of
Pennsylvania School of Medicine, Philadelphia, Pa.) was PCR amplified
using an upstream primer containing a BamHI site and a
downstream primer containing a mutated stop codon followed by the HA
epitope sequence and a HindIII restriction site. The PCR
product was BamHI-HindIII digested and
subcloned into the CMV-based vector pMT.
(vii) MSCV-6×His-cJun.
The
BamHI-HindIII Klenow-blunted fragment
containing the His6-tagged c-Jun cDNA was subcloned into
the HpaI site of the retroviral vector MSCV-puro (Clontech).
(viii) pGEX-FUS-Pep1(241-270), pGEX-FUS-Pep2(308-337),
pGEX-FUS-Pep3(342-376), and pGEX-FUS-Pep4(428-456).
FUS cDNA
fragments encoding FUS amino acids 241 to 270 (Pep1), 308 to 337 (Pep2), 342 to 376 (Pep3), and 428 to 456 (Pep4) were generated by PCR
performed on plasmid pBS-FUS using upstream primers containing a
BamHI restriction site followed by an ATG codon at the 5'
end and downstream primers carrying a stop codon followed by an
EcoRI site at the 3' end. The gel-purified fragments were
phosphorylated, digested with BamHI-EcoRI, and
directionally subcloned into the BamHI-EcoRI
sites of the pGEX-2T vector (Pharmacia Biotech). pGEX-FUS(1-240) and
pGEX-FUS(240-526) have been described previously (30).
pMT107 (His6-tagged ubiquitin), pMT108 (HA-tagged c-Jun),
and pMT35 (His6-tagged c-Jun) were the kind gifts of Dirk Bohmann (European Molecular Biology Laboratories, Heidelberg, Germany).
Plasmid ZZ5 was a kind gift from S. Matsufuji (Jikei University, Tokyo,
Japan). The LXSP retroviral vector was the kind gift of A. Sacchi
(Regina Elena Cancer Institute, Rome, Italy). Wild-type (WT) and
dominant negative (APF) Jun NH2-terminal kinase CMV-based
expression plasmids (15) were the kind gift of R. J. Davis (University of Massachusetts Medical School, Worcester, Mass.).
pRSV-v-Jun was a kind gift of E. J. Black and D. A. F. Gillespie (Beatson Institute for Cancer Research, Bearsden, Glasgow, United Kingdom). The transactivation-deficient S63/73L c-Jun mutant (32) cloned into the mammalian expression vector pMT2 was a kind gift of J. Woodgett (Ontario Cancer Institute, Toronto, Ontario, Canada).
Enzyme inhibitors.
Where indicated, cells were IL-3 starved
or IL-3 and serum starved (8 h) in the presence of kinase, protease, or
proteasome inhibitors used at the following concentrations: calphostin
C, 200 ng/ml (Calbiochem); N-acetyl-Leu-Lev-Nle-CHO (ALLM),
25 µM (Calbiochem); N-acetyl-Leu-Lev-Met-CHO (ALLN), 25 µM (Calbiochem); lactacystin, 10 µM (Calbiochem); and MG 132, 40 µM (Calbiochem).
Western blotting, immunoprecipitation, and Ni-NTA-mediated nickel
chromatography.
Cells were harvested, washed twice with ice-cold
PBS, and lysed (107 cells/100 µl of lysis buffer) in
HEPES buffer (10 mM HEPES [pH 7.5], 150 mM NaCl, 10% [vol/vol]
glycerol, 1 mM EDTA, 1 mM dithiothreitol, 1 mM phenylmethylsulfonyl
fluoride, 25 µg of aprotinin per ml, 10 µg of leupeptin per ml, 100 µg of pepstatin A per ml, 5 mM benzamidine, 1 mM
Na3VO4, 50 mM NaF, 10 mM
-glycerolphosphate) containing 1% (vol/vol) NP-40. Lysates and immunoprecipitated proteins
were obtained and processed as described previously (29). Nuclear and cytoplasmic subcellular fractions were obtained as follows.
Cells (107) were washed twice in ice-cold PBS and lysed in
1 ml of isotonic buffer (150 mM NaCl, 20 mM HEPES [pH 7.5])
supplemented with 0.2% NP-40. After disruption of the cytoplasmic
membrane, nuclei were collected by centrifugation (5 min at 500 × g and 4°C), lysed in isotonic buffer supplemented with 1%
NP-40, and clarified by centrifugation. FUS antiserum was obtained by
rabbit immunization with the agarose-coupled glutathione
S-transferase (GST) FUS(1-240) (N-terminal FUS, amino acids
1 to 240) fusion protein and used at a 1:5,000 dilution.
Ni-nitrilotriacetic acid (NTA)-mediated nickel chromatography (Ni-NTA
agarose: Qiagen Inc., Valencia, Calif.) was performed under denaturing
(4) or nondenaturing conditions (Ni-NTA pull-down assay) as
suggested by the manufacturer.
Pulse-chase experiments.
32D WT FUS and 32DBCR-ABL cells
expressing WT or S256A HA-tagged FUS were cultured for 90 min in RPMI
1640 without methionine and supplemented with 10% dialyzed FBS (Gibco
BRL, Grand Island, N.Y.) and 2 ng of recombinant murine IL-3 (Gibco
BRL) per ml at 106 cells/ml. The cells were washed and
resuspended (5 × 106 cells/ml) in medium containing
250 µCi of [35S]methionine per ml (NEN; Life Science
Products). After 1 h, the cells were washed with
methionine-containing RPMI and cultured (105 cells/ml) for
12 h in IL-3-containing medium or in serum- and IL-3-deprived
medium, supplemented with an excess of L-methionine (3 mg/ml; Gibco BRL). At different times, the cells were harvested and
lysed in isotonic buffer (20 mM HEPES [pH 7.5], 150 mM NaCl, 1%
NP-40) supplemented with protease and phosphatase inhibitors used at
the indicated concentrations. Precleared extracts were incubated at
4°C for 2 h with protein G plus (Oncogene Research Products)-coupled anti-HA antibody (Babco, Berkeley, Calif.). Immunoprecipitated proteins were resolved by sodium dodecyl
sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), visualized by
autoradiography upon transfer onto a nitrocellulose membrane, and
analyzed by densitometry. The half-lives of WT and S256A FUS proteins
(t1/2) were calculated using the formula
t1/2 = (0.693t)/ln
(Nt/N0) as described previously
(24).
In vivo 32P labeling.
WT and S256A
FUS-expressing 32DBCR-ABL cells were washed three times in
phosphate-free RPMI (Gibco BRL), phosphate purged for 3 h, and
incubated for 3 h in phosphate-free RPMI containing 0.3 mCi of
[32P]orthophosphate (New England Nuclear, Boston, Mass.)
per ml, 0.1% bovine serum albumin, and 25 mM HEPES (pH 7.4).
Isotype-matched antibody-precleared and protein G-agarose (Pharmacia,
Piscataway, N.J.)-precleared lysates were used in immunoprecipitation
with an anti-HA antibody previously coated with protein G-agarose. Immunoprecipitates were resolved by SDS-PAGE (4 to 15%
polyacrylamide), transferred to nitrocellulose filters, and exposed for autoradiography.
Recombinant protein purification and PKC assay.
BL-21 (DH3)
cells were transformed with plasmid pGEX-FUS(1-240),
pGEX-FUS(240-526), pGEX-FUS-Pep1, pGEX-FUS-Pep2, pGEX-FUS-Pep3, or
pGEX-FUS-Pep4, encoding, respectively, GST fused in frame with the FUS
N-terminal amino acids 1 to 240, C-terminal amino acids 240 to 526, peptide 1 (amino acids 241 to 270 [RGRGGGRGGRGGMGGSDRGGFMKFGGPRDQ]), peptide 2 (amino acids 308 to 337 [GIIKTNKKTGQPMINLYTDRETGKLKGEAT]), peptide 3 (amino acids 342 to 376 [DPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNR]), or peptide 4 (amino acids 428 to 456 [PNPTCENMNFSWRNECNQCKAPKPDGPGG]) containing
putative PKC
II phosphorylation sites (underlined). Purified proteins were obtained as specified by the manufacturer (Pharmacia Biotech).
PKC
II serine/threonine kinase activity was assayed using an in vitro
PKC assay kit from Upstate Biotechnology, Inc. (UBI), with a
recombinant PKC
II (UBI) and 1 µg of N-terminal GST-FUS(1-240), C-terminal GST-FUS(240-526), GST-FUS-Pep1, GST-FUS-Pep2, GST-FUS-Pep3, or GST-FUS-Pep4 as the substrate, as suggested by the manufacturer (UBI). The reaction products were fractionated by SDS-PAGE (4 to 15%
polyacrylamide), and the gel was stained with Coomassie blue, dried,
and exposed for autoradiography.
Northern blot analysis.
Total RNA was extracted using
Tri-Reagent (Molecular Research Center, Inc.). For Northern blot
analysis, RNA (15 µg) was fractionated onto denaturing 1%
agarose-6.6% formaldehyde gels, transferred to a nylon membrane
(Amersham), and hybridized to radiolabeled full-length FUS cDNA
(8).
 |
RESULTS |
BCR-ABL prevents proteasome-mediated FUS degradation.
Induction of FUS binding activity in BCR-ABL-expressing 32Dcl3 cells is
associated with enhanced expression of FUS (30). To
determine whether the induction of FUS expression reflects an increase
in mRNA levels or enhanced FUS protein stability, Northern and Western
blots were performed using total RNA or cell extracts from parental and
BCR-ABL-expressing 32Dcl3 cells cultured in the presence of IL-3 or
after 12 h of IL-3 deprivation. Compared to parental 32Dcl3 cells,
BCR-ABL-expressing cells showed higher levels of FUS mRNA only when
cultured in the absence of IL-3 (Fig. 1A). FUS protein was undetectable in
IL-3-starved parental 32Dcl3 cells, whereas low levels of full-length
FUS and faster-migrating forms, probably representing FUS degradation
products, were detected when these cells where cultured in the presence
of IL-3 (Fig. 1A). By contrast, FUS protein was abundant in
BCR-ABL-expressing cells regardless of the culture conditions (Fig.
1A). Together, these findings suggest a role of BCR-ABL in preventing
FUS degradation. Indeed, pulse-chase experiments performed with
parental and BCR-ABL cells grown in the presence of IL-3 and
ectopically expressing the HA-tagged FUS to facilitate its detection
revealed that the t1/2 of newly synthesized FUS
was at least ~4.5 times longer in BCR-ABL-expressing cells
(t1/2
11.3 h) than in the parental 32Dcl3 cells (t1/2
2.5 h) (Fig.
1B).

View larger version (54K):
[in this window]
[in a new window]
|
FIG. 1.
FUS expression, stability, and proteasome-dependent
degradation. (A) Northern (top panel) and Western blot (bottom panel)
analysis of FUS expression in parental and BCR-ABL-expressing 32Dcl3
cells in the presence of IL-3 (lanes 3 and 4) or after IL-3-deprivation
for 8 h (lanes 1 and 2). rRNA and actin levels were used as
controls for RNA and protein loading, respectively. (B) Stability of
FUS in IL-3-cultured parental and BCR-ABL-expressing 32Dcl3 cells
ectopically expressing the HA-tagged WT FUS. The turnover of FUS was
monitored by a pulse-chase assay and quantitated by densitometry. Each
point on the graph represents the mean and standard deviation of the
relative amount of FUS during the chase period;
t1/2 values were calculated using the formula
reported in Materials and Methods. The graph is representative of three
independent experiments with similar results. (C) Effect of proteasome
(lactacystin [Lacta.] and MG132), calpain and proteasome (ALLN), and
calpain (ALLM) inhibitors on endogenous FUS expression in IL-3-deprived
(8 h), parental, and BCR-ABL-expressing cells. FUS was detected using
antiserum raised against the N-terminal region (amino acids 1 to 240)
of FUS. (D) Effect of ALLN on nuclear and cytoplasmic levels of
HA-tagged FUS. Western blots show expression of HA-tagged FUS, hnRNP
C1/2, 14-3-3 , and hnRNP A1 in nuclear and cytoplasmic fractions of
32Dcl3 cells (cultured in IL-3, IL-3 starved [for 8 h], or IL-3
starved in the presence of ALLN). Expression of hnRNP C1/2 was used as
nuclear marker, while that of 14-3-3 was used as cytoplasmic marker.
The anti-hnRNP C1/2 (4F4) and the anti-hnRNP A1 (9H10) monoclonal
antibodies were a kind gift of G. Dreyfuss (Howard Hughes Medical
Institute, University of Pennsylvania School of Medicine, Philadelphia,
Pa.), while HA-tagged FUS and 14-3-3 were detected using monoclonal
anti-HA and anti 14-3-3 (Santa Cruz Biotechnology, Santa Cruz,
Calif.) antibodies. Data are representative of three different
experiments with similar results.
|
|
To investigate which proteolytic pathway might be responsible for FUS
degradation, inhibitors of Ca
2+-dependent neutral proteases
calpains (ALLN and ALLM), caspases
(DEVD and ZVAD-FMK), and the
proteasome catalytic activities (lactacystin,
MG132, and ALLN), were
assayed for their ability to rescue FUS
expression in 32Dcl3 cells
deprived of IL-3 for 8 h. Indeed, FUS
expression was restored to
levels comparable to those of IL-3-cultured
cells only when parental
cells were IL-3 starved in the presence
of 25 µM ALLN, 40 µM MG132,
or 10 µM lactacystin (Fig.
1C), whereas
the calpain inhibitor 25 µM
ALLM (Fig.
1C) and all the other inhibitors
had no effect (data not
shown). Thus, FUS degradation appears
to be proteasome dependent. Note
that FUS levels were not downmodulated
by growth factor deprivation of
BCR-ABL-expressing cells and that
the faster-migrating bands recognized
by the polyclonal anti-FUS
serum in parental 32Dcl3 cells (Fig.
1C,
lane 1) became undetectable
after treatment with the proteasome
inhibitors (lanes 5 and 7),
further suggesting that they represent
cleavage products of FUS.
Like the endogenous FUS, levels of the
ectopically expressed HA-tagged
FUS were also regulated in a
proteasome-dependent manner and,
as expected, most of the HA-tagged FUS
was detected in the nucleus
(Fig.
1D, top panel). Interestingly, the
FUS-associated hnRNP
A1 protein was also protected from
proteasome-dependent degradation
(Fig.
1D, lower panel) and was not
downmodulated in BCR-ABL-expressing
cells (data not
shown).
Proteasome-mediated proteolysis of FUS does not require its
ubiquitination.
Most cellular proteins targeted for
proteasome-dependent degradation undergo an enzymatic modification
whereby they are covalently bound to ubiquitin molecules in the form of
polyubiquitin chains which function as a degradation signal
(31). To determine whether FUS is a substrate for
ubiquitination, 293T cells were cotransfected with HA-tagged FUS and
His6-tagged ubiquitin plasmids and assessed for
ubiquitination. FUS was readily detectable in total lysates (Fig.
2, lane 8) but not in the Ni-NTA-purified
fractions (lane 4), suggesting that it was not ubiquitinated at
detectable levels. By contrast, the HA-tagged FUS-associated protein
hnRNP A1 (42) and the control HA-tagged c-Jun were
polyubiquitinated, as indicated by the multiple slowly migrating forms
detected by the anti-HA antibody (lanes 2 and 3). FUS
polyubiquitination was also undetectable in Western blots using FUS
antiserum on anti-HA immunoprecipitates from 32Dcl3 and 32DBCR-ABL
cells expressing the HA-tagged ubiquitin (not shown). Accordingly, FUS
appears to be one of an unknown number of proteins recognized and
degraded by the proteasome without undergoing ubiquitination, although
it cannot be excluded that low levels of ubiquitination may contribute
to its degradation.

View larger version (46K):
[in this window]
[in a new window]
|
FIG. 2.
FUS proteolysis does not require its ubiquitination. An
in vivo ubiquitination assay of c-Jun, hnRNP A1, and FUS was performed.
Shown is a Western blot with an anti-HA antibody on nickel
chromatography-purified (Ni-NTA resin under denaturing conditions)
His6-ubiquitinated proteins (lanes 1 to 4) or on total-cell
lysates (lanes 5 to 8) from 293T cells transfected with
His6-tagged ubiquitin (lanes 1 to 8) along with HA-hnRNP A1
(lanes 2 and 6), HA-c-Jun (lanes 3 and 7), or HA-FUS (lanes 4 and 8).
Data are representative of three independent experiments with similar
results.
|
|
BCR-ABL-dependent PKC
II activity is required for FUS protein
stability.
The DNA binding activity of FUS in BCR-ABL-expressing
32Dcl3 cells was inhibited by treatment with a PKC
II-specific
inhibitor or upon expression of a PKC
II dominant-negative mutant
(30). To determine whether the impairment in FUS binding
activity is accompanied by a progressive decline in FUS expression, we
assessed FUS levels in BCR-ABL-expressing cells treated with calphostin C, a specific inhibitor of conventional PKCs (39). In IL-3- and serum-starved BCR-ABL-expressing cells treated with a calphostin C
concentration which does not induce apoptosis (12), FUS
levels were barely detectable at 8 h and undetectable at 12 h, whereas they remained unchanged in untreated cells (Fig.
3A). The decreased FUS expression in
calphostin C-treated cells was not due to reduced mRNA levels (Fig.
3B). The proteasome inhibitor ALLN rescued FUS protein expression in
8-h calphostin C-treated BCR-ABL-expressing 32Dcl3 cells (Fig. 3A),
suggesting that PKC
II protects FUS from proteasome-mediated
degradation. The potential role of PKC
II phosphorylation in FUS
stability was further investigated by identifying potential
phosphorylation sites and by assessing the properties of proteins
carrying a mutated phosphorylation site. PROSITE database analysis of
the FUS protein sequence revealed multiple potential PKC
phosphorylation sites clustered between amino acids 240 and 526; thus,
GST fusion proteins with various FUS peptides were generated and tested
as PKC
II substrates. FUS peptides 1 (amino acids 241 to 270) and 2 (amino acids 308 to 337) were heavily phosphorylated, while
phosphorylation of peptides 3 (amino acids 342 to 376) and 4 (amino
acids 428 to 456) was barely detectable or undetectable (Fig. 3C, lanes
1 to 4). Consistent with the results of a previous study
(30), the C terminus but not the N terminus FUS was highly
phosphorylated (lanes 5 and 6).

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 3.
PKC-dependent FUS expression and identification of FUS
PKC II phosphorylation sites. (A) Western blot of FUS expression in
BCR-ABL-expressing 32Dcl3 cells untreated or treated for the indicated
times with calphostin C, alone or in the presence of the proteasome
inhibitor ALLN. Actin expression was used as a control. (B) Northern
blot of FUS expression in calphostin C-treated (1.5 to 8 h)
BCR-ABL-expressing 32Dcl3 cells. (C) In vitro kinase assay (top panel)
with recombinant PKC II as the active kinase and GST-FUS fusion
proteins as the substrate. The N-terminal (amino acids 1 to 240) (lane
5) and the C-terminal (amino acids 240 to 526) (lane 6) regions of FUS
and four different FUS peptides (lanes 1 to 4) containing the putative
PKC phosphorylation sites fused to GST are visible after Coomassie
staining of the SDS-PAGE-fractionated kinase reaction products (bottom
panel). Data are representative of three different experiments with
similar results.
|
|
FUS stability and resistance to proteasome degradation depends on
its phosphorylation at serine 256.
Serine phosphorylation of FUS
is required for its DNA binding activity (30), and peptide
1, RGRGGGRGGRGGMGGSDRGGFNKFGGPRDQ (amino acids
241 to 270) which is heavily phosphorylated, contains only one PKC
II
phosphorylation site (serine 256 of the SDR motif), while the four
PKC
II phosphorylation sites present in peptide 2 do not include
serine residues (see Materials and Methods). Accordingly, we generated
HA-tagged S256A and S256D FUS mutants to investigate their biochemical
properties and susceptibility to proteasome-dependent degradation.
Parental 32Dcl3 cells stably transfected with HA-tagged WT FUS or with
the S256A mutant showed downmodulated FUS expression after IL-3
starvation, which was restored by treatment with the proteasome
inhibitor lactacystin (Fig. 4A, left
panel). By contrast, expression of the S256D mutant remained unchanged
upon IL-3 removal and after inhibition of proteasome activity (Fig. 4A,
left panel). As expected, levels of WT FUS in transfected
BCR-ABL-expressing cells were not altered after 8 to 10 h in IL-3-
and serum-deprived cultures; under the same culture conditions,
expression of the S256A FUS mutant was markedly impaired but was
restored by lactacystin (Fig. 4A, right panel). Consistent with the
propensity of the S256A FUS mutant to undergo degradation upon serum
and IL-3 deprivation of BCR-ABL-expressing cells, the
t1/2 of newly synthesized S256A FUS was
considerably shorter (t1/2
1.5 h)
than that of WT FUS (t1/2
10.8 h)
(Fig. 4B). The S256A mutant retained the ability to associate with
PKC
II (data not shown) but was less phosphorylated in vivo
(approximately 50%) than was WT FUS (Fig. 4C), suggesting that serine
256 is also an in vivo phosphorylation site. Moreover, the S256A FUS mutant lost the ability to bind DNA (data not shown), and the relative
amount of FUS in complex with hnRNP C1/2 and hnRNP A1, two
FUS-associated proteins (42), was larger in the anti-HA immunoprecipitates from S256A FUS-expressing cells than from WT FUS- or
S256D FUS-expressing cells (data not shown), suggesting that FUS
function is regulated by serine 256 phosphorylation.

View larger version (54K):
[in this window]
[in a new window]
|
FIG. 4.
Role of serine 256 in expression, stability,
proteasome-mediated degradation, and in vivo phosphorylation of FUS.
(A) HA-FUS levels in parental (left panel) and BCR-ABL-expressing
(right panel) 32Dcl3 cells stably expressing WT FUS or the S256A or
S256D mutant. Cells were maintained in the presence of IL-3 or were
IL-3 deprived (for 8 h) in the presence or absence of the
proteasome inhibitor lactacystin (Lacta). Actin levels were used as a
control. (B) Stability of newly synthesized WT FUS and S256A FUS mutant
in IL-3- and serum-deprived (8 h) 32DBCR-ABL cells. Each point of the
graph represents the mean and standard deviation of the relative
amounts of WT FUS and S256A FUS during the chase period. Values on the
graph are representatives of three independent experiments. (C) FUS
phosphorylation in in vivo 32P-labeled WT FUS- and
S256A-expressing 32DBCR-ABL cells (lanes 1 and 2), and amount of
immunoprecipitated (IP) WT and S256A FUS (lanes 3 and 4). Data are
representative of three experiments with similar results.
|
|
c-Jun requirement for proteasome-dependent FUS proteolysis.
With the exception of the antizyme-dependent degradation of (ODC)
(1), the mechanisms involved in the proteasome-dependent degradation of nonubiquitinated substrates are largely undefined. Upon
formation of a heterodimeric complex, c-Jun induces the ubiquitination and the proteasome-dependent degradation of the associated ATF2 protein
(14). In experiments assessing the potential role of antizyme and c-Jun in FUS degradation, we found that antizyme expression had no effect on FUS levels in transfected 293T cells (Fig.
5A, lane 5) while FUS degradation was
induced by expression of two different plasmids carrying the
His6-tagged c-Jun cDNA (Fig. (lanes 2 and 3) and it was
prevented when the cotransfected cells were treated with the proteasome
inhibitor lactacystin (lane 10). Moreover, c-Jun expression promoted
the proteolysis of the S256A but not S256D FUS mutant (lanes 6 to 9),
suggesting that the effects of c-Jun are specific and that
dephosphorylation of serine 256 is a prerequisite for c-Jun-mediated
FUS degradation by the proteasome machinery. Overexpression of the
HA-tagged c-Myb, used as control for the effect of an ectopic protein
on FUS expression, did not alter FUS levels (lane 4). Of note,
overexpression of c-Jun had no effect on the mRNA levels of endogenous
and exogenous FUS (Fig. 5B). To determine whether BCR-ABL prevents
c-Jun-induced FUS degradation, expression of the HA-tagged FUS was
assessed in parental and BCR-ABL cells overexpressing WT FUS, as well
as in 32Dcl3 cells expressing the S256D FUS mutant, 48 h after
infection with a retrovirus carrying the full-length c-Jun cDNA.
Exogenous WT FUS expression was markedly downmodulated by c-Jun in
parental cells but not in BCR-ABL-expressing 32Dcl3 cells (Fig. 5C,
lanes 4 and 5). Moreover, c-Jun overexpression had no effect on the levels of S256D FUS in 32Dcl3 cells expressing this mutant (lane 6).
The c-Jun-dependent degradation of WT FUS in 293T cells was blocked by
coexpression of c-Jun NH2-terminal kinase 1 (JNK1) but not
by a dominant-negative JNK1 (15) (Fig.
6A), suggesting that expression of
nonphosphorylated c-Jun is required for proteasome-mediated FUS
proteolysis. Overexpression of v-Jun, which is unable to associate with
JNKs and cannot be ubiquitinated in vivo (9, 39), induced FUS degradation (Fig. 6B, lane 2), further indicating that this effect
is not dependent on Jun-JNK interaction or c-Jun ubiquitination. In
addition, expression of S63/73L c-Jun, a mutant which is defective in
transactivation (16, 32), induced FUS proteolysis as
effectively as did wild-type c-Jun (lanes 3 and 4), suggesting that FUS
degradation is not mediated by protein(s) whose expression is
transcriptionally regulated by c-Jun.

View larger version (26K):
[in this window]
[in a new window]
|
FIG. 5.
c-Jun requirement for FUS proteasome-dependent
degradation. (A) HA-FUS expression (top panel) in transiently
transfected 293T cells (lane 1), cotransfected with two different c-Jun
expression plasmids (pMT-c-Jun [pMT35] and MSCV-c-Jun) (lanes 2 and
3, respectively), with pMT HA-c-Myb (lane 4), or with a CMV-based
vector containing the full-length antizyme (AZ) cDNA (lane 5).
Expression of S256A FUS and S256D FUS mutants upon transient
transfection in 293T cells (lanes 6 and 8) or cotransfection with
pMT-c-Jun (lanes 7 and 9) is also shown. 293T cells were also
cotransfected with WT HA FUS and pMT-c-Jun and treated for 8 h
with the proteasome inhibitor lactacystin before being subjected to
lysis (lane 10). c-Jun (middle panel) and HSP90 (bottom panel)
expression were monitored as controls. (B) Ectopic (top panel) and
endogenous (middle panel) FUS mRNA expression in parental 293T cells
(lane 1) or in cells transfected with the LXSP HA-FUS plasmid alone
(lane 2) or cotransfected with pMT-c-Jun (lane 3). Ethidium bromide
staining of rRNA is shown as a control for equal loading (bottom
panel). (C) Effect of transient expression of c-Jun (middle panel) on
HA-FUS levels (top panel) in retrovirus-infected parental or
BCR-ABL-expressing 32Dcl3 cells constitutively expressing HA-tagged WT
FUS or S256D FUS. HSP90 levels (bottom panel) were monitored as a
control of equal loading.
|
|

View larger version (40K):
[in this window]
[in a new window]
|
FIG. 6.
Effect of JNK1, v-Jun, and S63/73L c-Jun mutant on FUS
expression. (A) HA-FUS expression (top row) in lysates of 293T cells
transfected with WT HA-FUS alone (lanes 1 to 4) or with c-Jun (lanes 2 to 4), FLAG-tagged WT JNK1 (lane 3), or a FLAG-tagged dominant-negative
JNK1 (lane 4). Phospho-c-Jun levels (second row) were detected using an
anti-phospho-Jun antibody (Santa Cruz Biotechnology, Inc.). Total c-Jun
levels (third row) were monitored using a mix (1:1) of polyclonal
anti-c-Jun antibodies (Santa Cruz Biotechnology and Oncogene Sciences).
Levels of exogenous JNK1 (fourth row) were detected using an anti-FLAG
antibody (Sigma). (B) HA-FUS expression (top row) in lysates of 293T
cells transfected with WT HA-FUS alone (lanes 1 to 4) or with v-Jun
(lane 2), c-Jun (lane 3), or the transactivation-deficient S63/73L
c-Jun mutant (lane 4). c-Jun and v-Jun levels (second row) were
detected using the polyclonal anti-c-Jun antibodies mix described for
panel A. HSP90 levels were monitored as control for equal loading.
|
|
FUS-hnRNP A1-c-Jun interaction is required for
proteasome-dependent FUS proteolysis.
In 293T cells, the
ectopically expressed HA-tagged FUS was no longer detectable 48 h
after coexpression with c-Jun (Fig. 5), and Western blots with the
anti-FUS antibody showed that c-Jun also induced degradation of the
endogenous FUS in a time-dependent manner (Fig.
7A, lanes 1 to 4).

View larger version (57K):
[in this window]
[in a new window]
|
FIG. 7.
Role of ubiquitination and of hnRNP A1 expression in
c-Jun-induced FUS degradation. (A) Endogenous FUS levels in 293T cells
that were not transfected (lane 1) or transfected with HA-c-Jun and
harvested 16, 24, and 36 h after transfection (lanes 2 to 4), and
an in vivo ubiquitination assay in 293T cells cotransfected with
His6-tagged ubiquitin, HA-c-Jun, and HA-WT FUS expression
plasmids and harvested 16, 24, 36, and 48 h after transfection
(lanes 7 to 10). Western blot with anti-FUS (upper panel) or anti-HA
(lower panel) antibody on total-cell lysate (lanes 1 to 4) or
Ni-NTA-purified proteins (lanes 5 to 11) from nontransfected cells
(lane 1), cells transfected with HA-c-Jun only (lanes 2 to 4), cells
transfected with His6-tagged ubiquitin (lanes 5 to 11),
plus HA-WT FUS (lane 6), cotransfected with HA-WT FUS and HA-c-Jun
(lanes 7-10), or plus HA-c-Jun only (lane 11). (B) Identification of
WT and S256D FUS-associated proteins in lactacystin-treated 293T cells.
Shown are Western blots with anti-ubiquitin (first panel), anti-c-Jun
(second panel), anti-hnRNP A1 (third panel), and anti-HA (fourth panel)
antibody on HA-immunoprecipitates (IP) from lysates of 293T cells
transfected with His6-tagged c-Jun (lanes 1 to 3) alone
(lane 1) or with HA-tagged WT FUS (lane 2) or S256D FUS (lane 3) and
treated for 8 h with 10 µM lactacystin before being subjected to
lysis. (C) Effect of hnRNP A1 on c-Jun-induced degradation of FUS.
Shown are Western blots with an anti-HA antibody on total-cell lysates
from 293T cells transfected (1:1:1 molar ratio) with HA-tagged WT FUS
(lanes 1 to 4 and 9 to 11) or S256D FUS mutant (lanes 5 to 8), plus
His6-tagged c-Jun (lanes 2, 3, 6, 7, 9, and 10) or
HA-tagged hnRNP A1 (lanes 3, 4, 7, 8, 10, and 11) left untreated (lanes
2 to 8) or treated (lanes 9 to 11) with the proteasome inhibitor
lactacystin. c-Jun and HSP90 levels were measured as internal controls
of transfection efficiency and equal loading (data not shown). (D)
Ni-NTA pull-down assay performed with the same lysate (1.5 mg) used in
the experiment in Fig. 6C. Shown are Western blots with an anti-HA
(upper panel) or anti-c-Jun (lower panel) antibody on total-cell
lysates (lane 1) or on nondenatured (N.D.) Ni-NTA-purified fractions
(lanes 2 to 7) from 293T cells transfected with HA-tagged WT FUS (lanes
1 to 4) or S256D FUS (lanes 5 to 7) along with His6-tagged
c-Jun (lanes 3, 4, 6, and 7) or HA-hnRNP A1 (lanes 1, 4, and 7). Data
are representative of three experiments with similar results.
|
|
If ubiquitination of FUS is important for its degradation, it might be
promoted by c-Jun expression and/or its physical interaction
with
c-Jun, as reported for the transcription factor ATF2 (
14).
To assess whether c-Jun expression is required for the induction
of FUS
ubiquitination, 293T cells were transfected with the
His
6-tagged
ubiquitin in the presence of HA-tagged c-Jun
and HA-tagged WT
FUS in a 1:1 molar ratio. At 16, 24, 36, and 48 h
posttransfection,
the formation of FUS-ubiquitin conjugates was
determined by nickel
chromatography performed under denaturing
conditions. Indeed,
Western blotting with the anti-FUS antibody did not
detect ubiquitinated
forms of FUS, whereas ubiquitinated c-Jun was
readily detectable
(Fig.
7A, lanes 5 to
11).
By the Ni-NTA pull-down assay, WT FUS, but not the S256D FUS mutant,
was found in complex with an ubiquitinated protein(s)
(data not shown),
suggesting that this FUS-associated protein
might serve as a chaperon
for targeting FUS to the 26S proteasome.
The nature of this protein was
further investigated by Western
blotting using an antiubiquitin
antibody on HA immunoprecipitates
from 293T cells transiently
transfected with HA-tagged WT FUS
or S256D FUS mutant and
His
6-tagged c-Jun and treated with 10
µM lactacystin to
prevent proteasome-dependent FUS degradation.
Indeed, a ubiquitinated
protein was readily detected in complex
with WT FUS and to a lesser
extent with the S256D FUS mutant (Fig.
7B, lanes 2 and 3,

-Ub
panel). In the same immunoprecipitates,
WT FUS, but not the
phosphomimetic S256D FUS mutant, was detected
in association with c-Jun
(Fig.
7B, lanes 2 and 3,

-cJun panel),
consistent with the notion
that lack of phosphorylation at serine
256 is required for proteasome
targeting and degradation of FUS.
Of note, WT FUS or its S256D
phosphomimetic mutant were found
in complex with the hnRNP A1 protein
(Fig.
7B,

-hnRNP A1 panel).
Since proteolysis of hnRNP A1 protein is
ubiquitin dependent (Fig.
2), it is conceivable that the ubiquitinated
protein which interacts
with FUS and may be required for FUS
degradation represents a
ubiquitinated form of hnRNP A1. To address
this possibility, 293T
cells were transiently transfected with the
HA-tagged WT or S256D
FUS together with the His
6-tagged
c-Jun and the HA-tagged hnRNP
A1 (1:1:1 molar ratio). Compared to the
effect of c-Jun alone
(~75% decrease in FUS levels), coexpression of
hnRNP A1 and c-Jun
enhanced the degradation of FUS (~95% decrease in
FUS levels)
(Fig.
7C, lanes 1 to 4). As expected, overexpression of
hnRNP
A1 and c-Jun had no effect on the levels of the S256D FUS mutant
(lanes 5 to 8). Like FUS, hnRNP A1 was also susceptible to the
degradation-promoting effect of c-Jun (lanes 3 and 4), and the
effect
was even more pronounced at a 1:1:0.5 molar ratio of c-Jun,
FUS, and
hnRNP A1, respectively (data not shown). In control experiments,
c-Jun
had no effect on the levels of ectopically expressed c-Myb,
which has a
short half-life and, like hnRNP A1, undergoes ubiquitin-dependent
proteasome degradation (data not shown). c-Jun-dependent FUS and
hnRNP
A1 degradation was prevented by the proteasome inhibitor
lactacystin
(10 µM) (Fig.
7C, lanes 9 to 11), which also allowed
the detection of
poly-ubiquitinated hnRNP A1 protein (lane 10).
To exclude the
possibility that c-Jun directly targets hnRNP A1
to ubiquitin-dependent
proteasome degradation, Ni-NTA pull-down
experiments were performed
with 1.5 mg of the same lysates of
293T cells expressing the
His
6-tagged c-Jun and WT FUS or S256D
FUS with or without
the HA-tagged hnRNP A1 protein (Fig.
7C).
c-Jun was found in
association with hnRNP A1 upon coexpression
with WT FUS (Fig.
7D, lane
4) but not with the S256D FUS mutant
(lane
7).
PKC
II-dependent phosphorylation of FUS serine 256 regulates survival and differentiation of myeloid precursor
32Dcl3 cells.
Downregulation of FUS expression accelerates
G-CSF-induced granulocytic differentiation of myeloid precursor 32Dcl3
cells, whereas overexpression of FUS induces apoptosis and consequently reduces the number of differentiated cells (30). To assess
the role of FUS serine 256 phosphorylation during G-CSF-dependent differentiation, parental 32Dcl3 cells or cells expressing the wild-type (32D WT FUS), the phosphomimetic (32D S256D FUS), or the
nonphosphorylatable (32D S256A FUS) FUS were cultured for 7 days in
medium containing G-CSF and monitored for FUS expression, survival, and differentiation.
Consistent with the results of a previous study (
29), WT HA
FUS levels were completely downmodulated after 3 days in G-CSF
(Fig.
8A, top panel); by contrast, S256A FUS
expression was suppressed
within 24 h (Fig.
8A, top panel), while
the levels of the phosphomimetic
FUS (S256D) were almost unaffected
after 2 days and remained readily
detectable after 3 days of treatment
with G-CSF (Fig.
8A, top
panel). Of interest, downregulation of FUS
levels temporally correlated
with G-CSF-induced c-Jun expression, which
peaked at 24 h and
became undetectable after 3 days of exposure to
G-CSF (Fig.
8A,
middle panel), consistent with the involvement of c-Jun
in the
induction of FUS degradation. Interestingly, overexpression of
the S256D FUS mutant was more potent than that of WT FUS in inducing
apoptosis of 32Dcl3 cells growing in G-CSF-containing medium (Fig.
8B
and C). Moreover, WT FUS-expressing cells escaping apoptosis
were able
to undergo terminal differentiation, while surviving
S256D
FUS-expressing cells remained undifferentiated (Fig.
8C)
and
proliferated in G-CSF-containing medium (data not shown).
Conversely,
mutation of FUS serine 256 to alanine abolished the
apoptotic effects
of FUS, allowing an apparently normal granulocytic
differentiation
(Fig.
8B and C). Together, these data support
a model in which FUS
degradation, possibly enhanced by c-Jun,
is required for granulocytic
differentiation of 32Dcl3 cells.

View larger version (68K):
[in this window]
[in a new window]
|
FIG. 8.
Effect of Ser 256 FUS mutant expression on G-CSF-induced
differentiation of 32Dcl3 cells. (A) Kinetics of FUS, c-Jun, and HSP90
expression (Western blotting) in a representative (of three for each
transfectant) clone of WT FUS, S256D FUS, or S256A FUS-expressing
32Dcl3 cells cultured in the presence of G-CSF for 0, 1, 2, or 3 days.
(B) Effect of G-CSF on the viability of parental and derivative cell
lines ectopically expressing WT FUS, S256A FUS, or S256D FUS. Each
point represents the average of three independent experiments and
standard deviation. The percentage cell death was determined by trypan
blue exclusion. (C) G-CSF-induced differentiation of parental and
representative (of three for each transfectant) 32Dcl3-derived cell
lines. Representative micrographs of May-Grunwald-Giemsa-stained
cytospins are shown.
|
|
 |
DISCUSSION |
The observation that BCR-ABL induces FUS expression and binding to
nucleic acids (30) led us to study the mechanisms
controlling FUS turnover in normal and BCR-ABL-expressing hematopoietic
cells. Overexpression of FUS in BCR-ABL-expressing cells reflects both increased mRNA levels and enhanced protein stability (Fig. 1). However,
treatment of BCR-ABL-expressing cells with the protein synthesis
inhibitor cycloheximide did not alter FUS DNA binding activity or its
expression (data not shown), suggesting that the primary mechanism for
the increase in FUS expression is posttranslational and unlikely to
depend on BCR-ABL-regulated pathways leading to enhanced FUS
transcription. The degradation of FUS in IL-3-deprived myeloid 32Dcl3
cells was specifically rescued by proteasome inhibitors but was not
dependent on its polyubiquitination. Although technical limitations may
prevent the detection of low levels of ubiquitination, it is
conceivable that FUS, like other proteins whose prototype is ODC
(1, 27), undergoes proteasome-dependent degradation without
prior ubiquitination. Probably, the association with adapter molecules,
like the antizyme for ODC, targets these proteins for degradation
(31). However, the cofactors that might promote the
proteasome-dependent degradation of two of these proteins, the nuclear
factors c-Jun (unconjugated form) (17) and SP1
(38), are still unknown.
The association of various kinases with their substrates is required in
several cases of ubiquitin-proteasome degradation, and the mechanism
responsible for triggering this process is, in most cases, dependent on
recognition of the phosphorylated substrate (13). However,
phosphorylation may also prevent the degradation of some substrates,
such as c-Jun, ATF2, and p53 (13, 27). FUS phosphorylation
by PKC
II appears to prevent its proteasome-dependent proteolysis.
Indeed, the S256D FUS mutant in which the serine phosphorylation site
was replaced with the phosphomimetic aspartic acid was less susceptible
to degradation induced by IL-3-deprivation, while the S256A mutant was
even more susceptible to degradation than was WT FUS (Fig. 4).
Expression of the S256A mutant in BCR-ABL-expressing cells was lower
than that of WT FUS (several S256A-expressing clones were analyzed),
downmodulated upon IL-3 and serum starvation, and restored upon
treatment with the proteasome inhibitor lactacystin (Fig. 4). Although
PKC
II was still able to associate with S256A FUS and this mutant
partially retained the ability to be phosphorylated in vivo (Fig. 4),
the serine-to-alanine mutation at amino acid 256 markedly altered the
half-life of FUS (Fig. 4), influenced its ability to associate with
hnRNP C1/2 and A1, suppressed its DNA binding activity, and had no
effect on the ability of G-CSF to induce the differentiation of 32Dcl3
cells (Fig. 8C). The location of the Ser 256 PKC
II phosphorylation
site within the first RGG box, reportedly involved in both RNA-protein
and protein-protein interaction (2, 5), raises the
possibility that an interacting protein associates with FUS when Ser
256 is not phosphorylated and promotes its proteasome-dependent
degradation. Unlike ODC, FUS degradation did not depend on expression
of the ODC-cofactor antizyme but was induced by c-Jun, previously shown
to promote the ubiquitin- and proteasome-dependent degradation of the
transcription factor ATF2 (14). The c-Jun-dependent
degradation of FUS was suppressed by expression of Jun kinase 1 but not
of a Jun kinase dominant negative mutant, suggesting that a
nonphosphorylated c-Jun is required for the effect; as expected, a
transactivation-defective c-Jun mutant (S63/73L) (32) was
highly effective in inducing FUS degradation, suggesting that
c-Jun-dependent gene expression is not required for the effect.
Moreover, since v-Jun lacks the c-Jun
domain responsible for the
interaction with JNK/SAPK and for c-Jun ubiquitination (9,
40), its ability to induce FUS proteolysis suggests that such an
effect is not dependent on c-Jun association with Jun kinase and/or on
c-Jun ubiquitination.
c-Jun targeting of FUS for proteasome-mediated degradation was
dependent on the phosphorylation status of FUS Ser 256, since the S256D
FUS mutant was resistant to c-Jun-induced proteolysis (Fig. 5). As
expected, WT-FUS levels in BCR-ABL-expressing cells were not altered by
c-Jun overexpression, confirming the role of BCR-ABL as a regulator of
FUS stability via the induction of PKC
II-dependent phosphorylation
and, probably, via its ability to activate Jun kinase (34).
Unlike the c-Jun-dependent degradation of ATF2, which requires ATF2
ubiquitination induced by formation of the c-Jun-ATF2 complex
(14), measurable levels of ubiquitinated FUS were not
detected (Fig. 7). Although not ubiquitinated at detectable levels, WT
FUS and, to a lesser extent, the phosphomimetic FUS mutant were found
in association with a ubiquitinated protein of ~40 kDa (Fig. 7),
suggesting that this FUS-associated protein might be responsible for
directing FUS to the proteasome. Since WT FUS interacts with
nonubiquitinated c-Jun (Fig. 7) and since the nonubiquitinable
v-Jun (40) induces FUS degradation (Fig. 6), it seems
unlikely that c-Jun itself targets FUS to the proteasome. c-Jun may,
however, favor the posttranslational modification(s) (i.e.,
ubiquitination) of this FUS-associated protein, providing a signal for
targeting FUS to the proteasome. hnRNP A1, a FUS-associated protein
(35), is polyubiquitinated and undergoes
proteasome-dependent degradation in a c-Jun-dependent
manner. These findings, along with the observation that hnRNP A1
enhances the c-Jun-induced degradation of FUS (Fig. 7), suggest that
the association with ubiquitinated hnRNP A1 represents one of the
mechanisms for targeting FUS to the proteasome. In fact, WT FUS was
found in complex with c-Jun and hnRNP A1, whereas the S256D FUS mutant,
although able to associate with hnRNP A1, did not interact with c-Jun
(Fig. 7). Since c-Jun itself does not interact with hnRNP A1 (Fig. 7), it seems likely that, directly or indirectly, it associates with the
FUS-hnRNP A1-containing complex promoting the proteasome-dependent degradation of both FUS and hnRNP A1. Levels of c-Jun were higher in
cells cotransfected with degradation-resistant S256D FUS than with
degradation-prone WT FUS (data not shown), suggesting that c-Jun in
complex with FUS and hnRNPA1 also undergoes degradation.
Although it has been reported that the proteasome specifically degrades
only the ubiquitinated subunits of a multiprotein complex
(19), there is also evidence that monoubiquitinated proteins
(20) and nonubiquitinated proteins or protein complexes, like ODC-antizyme, are efficiently degraded by the 26S proteasome (31). Thus, the formation of a complex with a ubiquitinated protein(s) might be sufficient for the proteasome degradation of
nonubiquitinated FUS.
Since expression of hnRNP A1 is abundant whereas c-Jun levels are
modulated during the cell cycle or upon induction of differentiation, hnRNP A1 might have primarily a "chaperone" function for FUS
degradation whereas the c-Jun-dependent effects on FUS stability might
be functionally significant during these processes. Consistent with previous studies (21), c-Jun expression is induced by G-CSF treatment of 32Dcl3 cells (Fig. 8) and precedes the downmodulation of
FUS, an event required for granulocytic differentiation
(30). Interestingly, the ectopically expressed
proteolysis-resistant S256D FUS mutant was only partly downmodulated
during G-CSF-induced differentiation of 32Dcl3 cells and caused massive
apoptosis and the emergence of a cohort of differentiation-arrested
cells growing in G-CSF-containing medium. In the apoptosis-resistant
BCR-ABL-expressing 32Dcl3 cells, failure to downmodulate FUS levels
might be one of the mechanisms preventing G-CSF-induced
differentiation, thereby contributing to leukemogenesis.
In addition to PKC
II-dependent phosphorylation of FUS at Ser 256, oncogenic BCR-ABL might suppress FUS proteolysis by causing an increase
in c-Jun phosphorylation mediated by active Jun kinase 1. Since
activation of the Jun kinase pathway is required for BCR-ABL-dependent
transformation (11, 34), it is possible that the oncogenic
effects of active Jun kinase are mediated by stabilization of FUS and,
perhaps, of other nuclear regulators.
In summary, FUS expression is, in part, controlled by a process of
proteasome-mediated degradation regulated by PKC
II-dependent phosphorylation, c-Jun expression, and possibly hnRNP A1
ubiquitination. The execution of these processes appears to be
important for granulocytic differentiation, while its suppression by
oncogenic BCR-ABL might contribute to BCR-ABL-dependent
leukemogenesis. This might be especially relevant in chronic
myelogenous leukemia blast crisis, in which BCR-ABL-expressing cells
are differentiation arrested and exhibit abundant FUS expression
(30).
 |
ACKNOWLEDGMENTS |
Angela Iervolino and Vincenzo Cesi contributed equally to this work.
We thank R. Trotta, P. Salomoni, M. Prisco, F. Peruzzi, and F. Condorelli for helpful discussions. We thank Yan Fu for assistance in
production of the anti-FUS polyclonal antibody.
D. Perrotti was supported in part by a fellowship from the
American-Italian Foundation for Cancer Research (New York, N.Y.). This
work was supported in part by NIH grants to B. Calabretta.
 |
FOOTNOTES |
*
Corresponding author. Mailing address for Danilo
Perrotti: Department of Microbiology and Immunology, Kimmel Cancer
Center, Thomas Jefferson University, BLSB 630, 233 S. 10th St.,
Philadelphia, PA 19107. Phone: (215) 503-4523. Fax: (215) 923-0249. E-mail: Danilo.Perrotti{at}mail.tju.edu. Mailing address
for Bruno Calabretta: Department of Microbiology and Immunology, Kimmel
Cancer Center, Thomas Jefferson University, BLSB 630, 233 S. 10th
St., Philadelphia, PA 19107. Phone: (215) 503-4522. Fax: (215)
923-0249. E-mail: Bruno.Calabretta{at}mail.tju.edu.
 |
REFERENCES |
| 1.
|
Bercovich, Z.,
Y. Rosenberg-Hasson,
A. Ciechanover, and C. Kahana.
1989.
Degradation of ornithine decarboxylase in reticulocyte lysate is ATP-dependent but ubiquitin-independent.
J. Biol. Chem.
264:15949-15952[Abstract/Free Full Text].
|
| 2.
|
Bouvet, P.,
J. J. Diaz,
K. Kindbeiter,
J. J. Madjar, and F. Amalric.
1998.
Nucleolin interacts with several ribosomal proteins through its RGG domain.
J. Biol. Chem.
273:19025-19029[Abstract/Free Full Text].
|
| 3.
|
Bureau, J. P.,
L. Henry,
A. Baz,
K. Scherrer, and M. T. Chateau.
1997.
Prosome (proteasome) changes during differentiation are related to the type of inducer.
Mol. Biol. Rep.
24:57-62[CrossRef][Medline].
|
| 4.
|
Campanero, M. R., and E. K. Flemington.
1997.
Regulation of E2F through ubiquitin-proteasome-dependent degradation: stabilization by the pRB tumor suppressor protein.
Proc. Natl. Acad. Sci. USA
94:2221-2226[Abstract/Free Full Text].
|
| 5.
|
Cartegni, L.,
M. Maconi,
E. Morandi,
F. Cobianchi,
S. Riva, and G. Biamonti.
1996.
hnRNP A1 selectively interacts through its Gly-rich domain with different RNA-binding proteins.
J. Mol. Biol.
259:337-348[CrossRef][Medline].
|
| 6.
|
Ciechanover, A.
1998.
The ubiquitin-proteasome pathway: on protein death and cell life.
EMBO J.
17:7151-7160[CrossRef][Medline].
|
| 7.
|
Cortez, D.,
L. Kadlec, and A. M. Pendergast.
1995.
Structural and signaling requirements for BCR/ABL-mediated transformation and inhibition of apoptosis.
Mol. Cell. Biol.
15:5531-5541[Abstract].
|
| 8.
|
Crozat, A.,
P. Aman,
N. Mandahl, and D. Ron.
1993.
Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma.
Nature
363:640-644[CrossRef][Medline].
|
| 9.
|
Dai, T.,
E. Rubie,
C. C. Franklin,
A. Kraft,
D. A. Gillespie,
J. Avruch,
J. M. Kyriakis, and J. R. Woodgett.
1995.
Stress-activated protein kinases bind directly to the delta domain of c-Jun in resting cells: implications for repression of c-Jun function.
Oncogene
10:849-855[Medline].
|
| 10.
|
Dai, Z.,
R. C. Quackenbush,
K. D. Courtney,
M. Grove,
D. Cortez,
G. W. Reuther, and A. M. Pendergast.
1998.
Oncogenic Abl and Src tyrosine kinases elicit the ubiquitin-dependent degradation of target proteins through a Ras-independent pathway.
Genes Dev.
12:1415-1424[Abstract/Free Full Text].
|
| 11.
|
Dickens, M.,
J. S. Rogers,
J. Cavanagh,
A. B. Raitano,
Z. Xia,
J. R. Halpern,
M. E. Greenberg,
C. L. Sawyers, and R. J. Davis.
1997.
A cytoplasmic inhibitor of the JNK signal transduction pathway.
Science
277:690-693[Abstract/Free Full Text].
|
| 12.
|
Evans, C. A.,
J. M. Lord,
P. J. Owen-Lynch,
G. Johnson,
C. Dive, and A. D. Whetton.
1995.
Suppression of apoptosis by v-ABL protein tyrosine kinase is associated with nuclear translocation and activation of protein kinase C in an interleukin-3-dependent haemopoietic cell line.
J. Cell Sci.
108:2591-2598[Abstract].
|
| 13.
|
Fuchs, S. Y.,
V. A. Fried, and Z. Ronai.
1998.
Stress-activated kinases regulate protein stability.
Oncogene
17:1483-1490[CrossRef][Medline].
|
| 14.
|
Fuchs, S. Y., and Z. Ronai.
1999.
Ubiquitination and degradation of ATF2 are dimerization dependent.
Mol. Cell. Biol.
19:3289-3298[Abstract/Free Full Text].
|
| 15.
|
Gupta, S.,
D. Campbell,
B. Derijard, and R. J. Davis.
1995.
Transcription factor ATF2 regulation by the JNK signal transduction pathway.
Science
267:389-393[Abstract/Free Full Text].
|
| 16.
|
Hunter, T., and M. Karin.
1992.
The regulation of transcription by phosphorylation.
Cell
70:375-387[CrossRef][Medline].
|
| 17.
|
Jariel-Encontre, I.,
M. Pariat,
F. Martin,
S. Carillo,
C. Salvat, and M. Piechaczyk.
1995.
Ubiquitinylation is not an absolute requirement for degradation of c-Jun protein by the 26 S proteasome.
J. Biol. Chem.
270:11623-11627[Abstract/Free Full Text].
|
| 18.
|
Jariel-Encontre, I.,
C. Salvat,
A. M. Steff,
M. Pariat,
C. Acquaviva,
O. Furstoss, and M. Piechaczyk.
1997.
Complex mechanisms for c-fos and c-jun degradation.
Mol. Biol. Rep.
24:51-56[CrossRef][Medline].
|
| 19.
|
Johnson, E. S.,
D. K. Gonda, and A. Varshavsky.
1990.
cis-trans recognition and subunit-specific degradation of short-lived proteins.
Nature
346:287-291[CrossRef][Medline].
|
| 20.
|
Johnson, E. S.,
B. Bartel,
W. Seufert, and A. Varshavsky.
1992.
Ubiquitin as a degradation signal.
EMBO J.
11:497-505[Medline].
|
| 21.
|
Kreider, B. L., and G. Rovera.
1992.
The immediate early gene response to a differentiative stimulus is disrupted by the v-abl and v-ras oncogenes.
Oncogene
7:135-140[Medline].
|
| 22.
|
Loidl, G.,
M. Groll,
H. J. Musiol,
R. Huber, and L. Moroder.
1999.
Bivalency as a principle for proteasome inhibition.
Proc. Natl. Acad. Sci. USA
96:5418-5422[Abstract/Free Full Text].
|
| 23.
|
Lugo, T. G.,
A. M. Pendergast,
A. J. Muller, and O. N. Witte.
1990.
Tyrosine kinase activity and transformation potency of bcr-abl oncogene products.
Science
247:1079-1082[Abstract/Free Full Text].
|
| 24.
|
Luscher, B., and R. N. Eisenman.
1988.
c-myc and c-myb protein degradation: effect of metabolic inhibitors and heat shock.
Mol. Cell. Biol.
8:2504-2512[Abstract/Free Full Text].
|
| 25.
|
Matsufuji, S.,
Y. Miyazaki,
R. Kanamoto,
T. Kameji,
Y. Murakami,
T. G. Baby,
K. Fujita,
T. Ohno, and S. Hayashi.
1990.
Analyses of ornithine decarboxylase antizyme mRNA with a cDNA cloned from rat liver.
J. Biochem. (Tokyo)
108:365-371[Abstract/Free Full Text].
|
| 26.
|
Murakami, Y.,
S. Matsufuji,
T. Kameji,
S. Hayashi,
K. Igarashi,
T. Tamura,
K. Tanaka, and A. Ichihara.
1992.
Ornithine decarboxylase is degraded by the 26S proteasome without ubiquitination.
Nature
360:597-599[CrossRef][Medline].
|
| 27.
|
Musti, A. M.,
M. Treier, and D. Bohmann.
1997.
Reduced ubiquitin-dependent degradation of c-Jun after phosphorylation by MAP kinases.
Science
275:400-402[Abstract/Free Full Text].
|
| 28.
|
Panagopoulos, I.,
N. Mandahl,
F. Mitelman, and P. Aman.
1995.
Two distinct FUS breakpoint clusters in myxoid liposarcoma and acute myeloid leukemia with the translocations t(12;16) and t(16;21).
Oncogene
11:1133-1137[Medline].
|
| 29.
|
Pear, W. S.,
G. P. Nolan,
M. L. Scott, and D. Baltimore.
1993.
Production of high-titer helper free retroviruses by transient transfection.
Proc. Natl. Acad. Sci. USA
90:8392-8396[Abstract/Free Full Text].
|
| 30.
|
Perrotti, D.,
S. Bonatti,
R. Trotta,
R. Martinez,
T. Skorski,
P. Salomoni,
E. Grassilli,
R. V. Iozzo,
D. R. Cooper, and B. Calabretta.
1998.
TLS/FUS, a pro-oncogene involved in multiple chromosomal translocations, is a novel regulator of BCR/ABL-mediated leukemogenesis.
EMBO J.
17:4442-4455[CrossRef][Medline].
|
| 31.
|
Pickart, C. M.
1997.
Targeting of substrates to the 26S proteasome.
FASEB J.
11:1055-1066[Abstract].
|
| 32.
|
Pulverer, B. J.,
J. M. Kyriakis,
J. Avruch,
E. Nikolakaki, and J. R. Woodgett.
1991.
Phosphorylation of c-jun mediated by MAP kinases.
Nature
353:670-674[CrossRef][Medline].
|
| 33.
|
Rabbitts, T. H.,
A. Forster,
R. Larson, and P. Nathan.
1993.
Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma.
Nat. Genet.
4:175-180[CrossRef][Medline].
|
| 34.
|
Raitano, A. B.,
J. R. Halpern,
T. M. Hambuch, and C. L. Sawyers.
1995.
The BCR/ABL leukemia oncogene activates Jun Kinase and requires Jun for transformation.
Proc. Natl. Acad. Sci. USA
92:11746-11750[Abstract/Free Full Text].
|
| 35.
|
Ron, D.
1997.
TLS-CHOP and the role of RNA-binding proteins in oncogenic transformation.
Curr. Top. Microbiol. Immunol.
220:131-142[Medline].
|
| 36.
|
Sawyers, C. L.,
W. Callahan, and O. N. Witte.
1992.
Dominant negative MYC blocks transformation by ABL oncogenes.
Cell
70:901-910[CrossRef][Medline].
|
| 37.
|
Shimizu, K.,
H. Ichikawa,
A. Tojo,
Y. Kaneko,
N. Maseki,
Y. Hayashi,
M. Ohira,
S. Asano, and M. Ohki.
1993.
An ets-related gene, ERG, is rearranged in human myeloid leukemia with t(16;21) chromosomal translocation.
Proc. Natl. Acad. Sci. USA
90:10280-10284[Abstract/Free Full Text].
|
| 38.
|
Su, K.,
M. D. Roos,
X. Yang,
I. Han,
A. J. Paterson, and J. E. Kudlow.
1999.
An N-terminal region of Sp1 targets its proteasome-dependent degradation in vitro.
J. Biol. Chem.
274:15194-15202[Abstract/Free Full Text].
|
| 39.
|
Tamaoki, T.
1991.
Use and specificity of staurosporine, UCN-01, and calphostin C as protein kinase inhibitors.
Methods Enzymol.
201:340-347[Medline].
|
| 40.
|
Treier, M.,
L. M. Staszewski, and D. Bohmann.
1994.
Ubiquitin-dependent c-Jun degradation in vivo is mediated by the delta domain.
Cell
78:787-798[CrossRef][Medline].
|
| 41.
|
Wong, K. K.,
X. Zou,
K. T. Merrell,
A. J. Patel,
K. B. Marcu,
S. Chellappan, and K. Calame.
1995.
v-Abl activates c-myc transcription through the E2F site.
Mol. Cell. Biol.
15:6535-6544[Abstract].
|
| 42.
|
Zinszner, H.,
R. Albalat, and D. Ron.
1994.
A novel effector domain from the RNA-binding protein TLS or EWS is required for oncogenic transformation by CHOP.
Genes Dev.
8:2513-2526[Abstract/Free Full Text].
|
| 43.
|
Zou, X., and K. Calame.
1999.
Signaling pathways activated by oncogenic forms of Abl tyrosine kinase.
J. Biol. Chem.
274:18141-18144[Free Full Text].
|
Molecular and Cellular Biology, August 2000, p. 6159-6169, Vol. 20, No. 16
0270-7306/00/$04.00+0
Copyright © 2000, American Society for Microbiology. All rights reserved.
This article has been cited by other articles:
-
Eiring, A. M., Neviani, P., Santhanam, R., Oaks, J. J., Chang, J. S., Notari, M., Willis, W., Gambacorti-Passerini, C., Volinia, S., Marcucci, G., Caligiuri, M. A., Leone, G. W., Perrotti, D.
(2008). Identification of novel posttranscriptional targets of the BCR/ABL oncoprotein by ribonomics: requirement of E2F3 for BCR/ABL leukemogenesis. Blood
111: 816-828
[Abstract]
[Full Text]
-
Kasbek, C., Yang, C.-H., Yusof, A. M., Chapman, H. M., Winey, M., Fisk, H. A.
(2007). Preventing the Degradation of Mps1 at Centrosomes Is Sufficient to Cause Centrosome Reduplication in Human Cells. Mol. Biol. Cell
18: 4457-4469
[Abstract]
[Full Text]
-
Galietta, A., Gunby, R. H., Redaelli, S., Stano, P., Carniti, C., Bachi, A., Tucker, P. W., Tartari, C. J., Huang, C.-J., Colombo, E., Pulford, K., Puttini, M., Piazza, R. G., Ruchatz, H., Villa, A., Donella-Deana, A., Marin, O., Perrotti, D., Gambacorti-Passerini, C.
(2007). NPM/ALK binds and phosphorylates the RNA/DNA-binding protein PSF in anaplastic large-cell lymphoma. Blood
110: 2600-2609
[Abstract]
[Full Text]
-
Chang, J. S., Santhanam, R., Trotta, R., Neviani, P., Eiring, A. M., Briercheck, E., Ronchetti, M., Roy, D. C., Calabretta, B., Caligiuri, M. A., Perrotti, D.
(2007). High levels of the BCR/ABL oncoprotein are required for the MAPK-hnRNP-E2 dependent suppression of C/EBP{alpha}-driven myeloid differentiation. Blood
110: 994-1003
[Abstract]
[Full Text]
-
Perrotti, D., Neviani, P.
(2007). From mRNA Metabolism to Cancer Therapy: Chronic Myelogenous Leukemia Shows the Way. Clin. Cancer Res.
13: 1638-1642
[Abstract]
[Full Text]
-
Guerzoni, C., Bardini, M., Mariani, S. A., Ferrari-Amorotti, G., Neviani, P., Panno, M. L., Zhang, Y., Martinez, R., Perrotti, D., Calabretta, B.
(2006). Inducible activation of CEBPB, a gene negatively regulated by BCR/ABL, inhibits proliferation and promotes differentiation of BCR/ABL-expressing cells. Blood
107: 4080-4089
[Abstract]
[Full Text]
-
Corradini, F., Cesi, V., Bartella, V., Pani, E., Bussolari, R., Candini, O., Calabretta, B.
(2005). Enhanced Proliferative Potential of Hematopoietic Cells Expressing Degradation-resistant c-Myb Mutants. J. Biol. Chem.
280: 30254-30262
[Abstract]
[Full Text]
-
Zou, J., Ichikawa, H., Blackburn, M. L., Hu, H.-M., Zielinska-Kwiatkowska, A., Mei, Q., Roth, G. J., Chansky, H. A., Yang, L.
(2005). The Oncogenic TLS-ERG Fusion Protein Exerts Different Effects in Hematopoietic Cells and Fibroblasts. Mol. Cell. Biol.
25: 6235-6246
[Abstract]
[Full Text]
-
Andreu, E. J., Lledo, E., Poch, E., Ivorra, C., Albero, M. P., Martinez-Climent, J. A., Montiel-Duarte, C., Rifon, J., Perez-Calvo, J., Arbona, C., Prosper, F., Perez-Roger, I.
(2005). BCR-ABL Induces the Expression of Skp2 through the PI3K Pathway to Promote p27Kip1 Degradation and Proliferation of Chronic Myelogenous Leukemia Cells. Cancer Res.
65: 3264-3272
[Abstract]
[Full Text]
-
Allemand, E., Guil, S., Myers, M., Moscat, J., Caceres, J. F., Krainer, A. R.
(2005). Regulation of heterogenous nuclear ribonucleoprotein A1 transport by phosphorylation in cells stressed by osmotic shock. Proc. Natl. Acad. Sci. USA
102: 3605-3610
[Abstract]
[Full Text]
-
Gustafson, W. C., Ray, S., Jamieson, L., Thompson, E. A., Brasier, A. R., Fields, A. P.
(2004). Bcr-Abl Regulates Protein Kinase C{iota} (PKC{iota}) Transcription via an Elk1 Site in the PKC{iota} Promoter. J. Biol. Chem.
279: 9400-9408
[Abstract]
[Full Text]
-
Boskovic, G., Desai, D., Niles, R. M.
(2002). Regulation of Retinoic Acid Receptor alpha by Protein Kinase C in B16 Mouse Melanoma Cells. J. Biol. Chem.
277: 26113-26119
[Abstract]
[Full Text]
-
Iervolino, A., Santilli, G., Trotta, R., Guerzoni, C., Cesi, V., Bergamaschi, A., Gambacorti-Passerini, C., Calabretta, B., Perrotti, D.
(2002). hnRNP A1 Nucleocytoplasmic Shuttling Activity Is Required for Normal Myelopoiesis and BCR/ABL Leukemogenesis. Mol. Cell. Biol.
22: 2255-2266
[Abstract]
[Full Text]
-
Wakino, S., Kintscher, U., Liu, Z., Kim, S., Yin, F., Ohba, M., Kuroki, T., Schonthal, A. H., Hsueh, W. A., Law, R. E.
(2001). Peroxisome Proliferator-activated Receptor gamma Ligands Inhibit Mitogenic Induction of p21Cip1 by Modulating the Protein Kinase Cdelta Pathway in Vascular Smooth Muscle Cells. J. Biol. Chem.
276: 47650-47657
[Abstract]
[Full Text]