Division of Clinical and Molecular
Endocrinology, Department of Medicine, and Department of Pharmacology,
New York University School of Medicine, New York, New York
10016,1 and Molecular Genetics and
Microbiology, University of Texas at Austin, Austin, Texas
787052
Received 24 August 2000/Returned for modification 12 October
2000/Accepted 8 January 2001
Members of the type II nuclear hormone receptor subfamily (e.g.,
thyroid hormone receptors [TRs], retinoic acid receptors, retinoid X
receptors [RXRs], vitamin D receptor, and the peroxisome proliferator-activated receptors) bind to their response sequences with
or without ligand. In the absence of ligand, these DNA-bound receptors
mediate different degrees of repression or silencing of gene expression
which is thought to result from the association of their ligand binding
domains (LBDs) with corepressors. Two related corepressors, N-CoR and
SMRT, interact to various degrees with the LBDs of these type II
receptors in the absence of their cognate ligands. N-CoR and SMRT have
been proposed to act by recruiting class I histone deacetylases (HDAC
I) through an association with Sin3, although they have also been shown
to recruit class II HDACs through a Sin3-independent mechanism. In this
study, we used a biochemical approach to identify novel nuclear factors
that interact with unliganded full-length TR and RXR. We found that the
DNA binding domains (DBDs) of TR and RXR associate with two proteins which we identified as PSF (polypyrimidine tract-binding
protein-associated splicing factor) and
NonO/p54nrb. Our studies indicate that PSF is a
novel repressor which interacts with Sin3A and mediates silencing
through the recruitment of HDACs to the receptor DBD. In vivo studies
with TR showed that although N-CoR fully dissociates in the presence of
ligand, the levels of TR-bound PSF and Sin3A appear to remain
unchanged, indicating that Sin3A can be recruited to the receptor
independent of N-CoR or SMRT. RXR was not detected to bind N-CoR
although it bound PSF and Sin3A as effectively as TR, and this
association with RXR did not change with ligand. Our studies point to a
novel PSF/Sin3-mediated pathway for nuclear hormone receptors, and
possibly other transcription factors, which may fine-tune the
transcriptional response as well as play an important role in mediating
the repressive effects of those type II receptors which only weakly
interact with N-CoR and SMRT.
 |
INTRODUCTION |
Nuclear hormone receptors comprise a
superfamily of ligand-dependent transcription factors which play
important roles in cell growth, differentiation, development, and
homeostasis (52). The nuclear hormone receptor superfamily
consists of type I and type II receptor subfamilies. Type I receptors
mediate the effects of glucocorticoids, estrogens, mineralocorticoids,
progestins, and androgens, while the type II receptors mediate the
actions of thyroid hormone (TRs), all-trans retinoic acid
(RA) (RARs), 9-cis RA (RARs and RXRs), and vitamin D (VDR).
The peroxisome proliferator-activated receptors (PPARs) are members of
the type II subfamily which mediate the effects of a wide variety of
physiologically important lipid-derived ligands. Type I and type II
receptors have similar modular structures consisting of a
variable-sized N-terminal A/B domain, a 68- to 70-amino-acid DNA
binding C domain (DBD), and a ~300-amino-acid ligand binding domain
(LBD) consisting of the D (hinge), E, and F regions (7,
52). The DBD is highly conserved among members of type I and
type II receptor subfamilies.
Type I receptors are thought to interact with their cognate DNA
sequences in regulated genes only in the presence of ligand, while type
II receptors appear to bind their cognate regulatory sequences in the
presence or absence of ligand. Transcriptional activation is thought to
be mediated by a ligand-dependent conformational change in the LBD
which recruits coactivators to the DNA-bound receptor
(52). Coactivators, identified by yeast two-hybrid screens, generally fall into two main groups: the p160/SRC family (SRC-1/NCoA-1 [39, 57, 77], TIF-2/GRIP-1/NCoA-2
[32, 33, 77, 79], AIB1/p/CIP/ACTR/RAC3/TRAM-1
[2, 11, 46, 74, 77]) and the CBP (CREB binding
protein)/p300 family (9, 30, 39). Coactivators which fall
outside of these groups include PGC-1 (60), ARA70
(88), p/CAF (5, 84), hNRC/ASC-2/RAP250/TRBP (6, 42, 44, 51), and NRIF3 (45), which
exhibits specificity for only the TRs and the RXRs. Using a biochemical
approach, the DRIPs (VDR-interacting proteins) (63, 64)
and TRAPs (TR-associated proteins) were identified as factors from HeLa
cells which associate with TR and VDR in the presence of ligand
(23, 37). The DRIPs and TRAPs are similar, if not
identical, multiprotein complexes which are human homologues of yeast
mediator/RNA polymerase II holoenzyme factors (37).
Members of the p160/SRC family (11, 69), CBP/p300
(3, 56), and p/CAF (84) are thought to act
through an intrinsic histone acetyltransferase activity which leads to
an increase in the level of histone acetylation.
In the absence of ligand, the binding of a number of type II receptors
(e.g., TRs and RARs) to their target DNA sequences leads to repression
or silencing of basal gene expression. Stimulation of gene
transcription by ligand is considered to result from both the reversal
of repression (8) and the recruitment of coactivators to
the DNA-bound receptor (57, 68). Repression was first
noted for unliganded TR and for v-ErbA (14), the
retroviral counterpart of the chicken TR
isoform (cTR
) of the
avian erythroblastosis virus which does not bind ligand. Evidence that
repression results from a ligand-dependent reversible interaction of a
cellular repressor(s) with the LBD of certain type II receptors first
came from studies using Gal4-TR LBD-VP16 chimeras (8).
Insertion of the TR LBD between the Gal4 DBD and the VP16 activation
domain was found to completely repress the activity of VP16. This
repression could be relieved by coexpression of the LBD of TR or RAR
which competed for a cellular repressor(s), and this apparent
derepression was reversed by ligand. Interestingly, the repression of
Gal4-TR LBD-VP16 was not reversed by expression of the LBD of RXR,
suggesting that the RXR LBD only weakly interacted with the cellular
repressor(s) (8).
Two related candidate corepressors, N-CoR and SMRT, which interact with
the LBDs of TR and RAR in the absence of ligand and dissociate in the
presence of ligand, have been cloned (12, 35). The
receptor interaction domains of SMRT and N-CoR are found in their
C-terminal regions, while the domains mediating repression are found in
the N-terminal half of each protein (12, 35, 67, 90). The
repressor domains were found to interact with Sin3 in vitro, suggesting
that repression is mediated through the recruitment of class I histone
deacetylases (HDAC1 to -3) to the promoter-bound unliganded receptor
(31, 43, 54, 82). These studies, along with an analysis of
the mechanism of repression by many other factors, have suggested that
gene silencing is an important component of gene regulation and
development, which is mediated through the recruitment of class I HDACs
through distinct multiprotein complexes coordinated by either Sin3
(31, 43, 54) or Mi-2/NuRD (41, 80, 92).
Factors thought to mediate repression through Sin3 include N-CoR/SMRT,
Mad, Mnt, MeCP2, UME6, and Ski/Sno (41). Recent studies,
however, have also raised the possibility for a direct in vivo
interaction between N-CoR/SMRT with class II HDACs (HDAC4 to -7)
independent of Sin3 (36, 40).
Almost all studies involved in the identification of nuclear receptor
corepressors and coactivators have utilized the receptor LBD rather
than full-length receptor. We have used full-length TRs and RXRs, in
both yeast two-hybrid (45, 51) and biochemical (59) approaches to identify novel corepressors and
coactivators that might require regions of these receptors other than
the LBD. We previously reported that three proteins (p55, p65, and
p100) from HeLa cell nuclear extracts bound in vitro to glutathione S-transferase (GST)-TR and to GST-RXR independent of ligand
binding (59). One of these proteins (p65) was identified
as TLS (translocated in liposarcoma). The receptor DBD and not the LBD
was found to be necessary for the association of TLS with TR or RXR,
although the affinity of interaction was enhanced by hinge region
residues just C terminal to the DBD (59).
In this paper we report the identification of p100 as PSF-A and p55 as
NonO/p54nrb. PSF is expressed as multiple cDNAs
designated A, B, C, and F (58). The A, B, and C PSF cDNAs
express the same protein but differ in their 3' untranslated regions.
The F cDNA encodes a shorter form of PSF. Thus, PSF protein is
expressed as two alternatively spliced forms, indicated as PSF-A and
PSF-F (58). NonO (mouse) (85) and
p54nrb (human) (21) are highly
conserved and differ by only one amino acid. Thus, throughout the paper
we generally refer to p55 as NonO/p54nrb.
Interestingly, TLS, PSF, and NonO/p54nrb each
contain RNA recognition motifs (RRMs), although the region of
interaction of these proteins with TR and RXR does not involve the RRM
of these proteins. The association of PSF-A and
NonO/p54nrb with TR and RXR was found to require
their DBDs with a segment of the hinge region just C terminal to the
DBD enhancing the interaction. PSF-A,
NonO/p54nrb, or TLS does not interact with the
LBD of TR or RXR (domains D, E, and F). The association of PSF-A,
NonO/p54nrb, or TLS with the DBD also occurs in
the presence of cognate DNA. The finding that TLS, PSF-A, and
NonO/p54nrb interact with the DBD of nuclear
hormone receptors provides further evidence for a multifunctional role
of the DBD in nuclear receptor function.
Prior to the cloning of PSF and NonO/p54nrb,
p100, and p55 were identified as part of a DNA-binding heterodimer, and
UV cross-linking suggested that p100 was the DNA-binding component of
the complex (91). The subsequent cloning of PSF
(58) and NonO/p54nrb (21,
85) indicated that the components of the DNA-binding heterodimer
were the same factors. PSF (polypyrimidine tract-binding protein
[PTB]-associated splicing factor) was cloned as a putative splicing
factor in association with PTB (58), although most of the
PSF in the nucleus does not appear to be associated with PTB
(53). NonO/p54nrb and PSF exhibit
about 70% identity within their RRMs (21, 85).
Since PSF and NonO/p54nrb contain highly
conserved RRMs, and PSF has been reported to play a possible role in
RNA splicing (27, 48, 50, 58, 76), we anticipated that
PSF-A and/or NonO/p54nrb might enhance the
regulation of gene expression by nuclear hormone receptors by somehow
coupling transcriptional activation with RNA splicing. Surprisingly, we
found that PSF functions as a transcriptional repressor and recruits
Sin3A to the receptor DBD. These studies provide evidence for
multifunctional activities of PSF and define a new pathway for
silencing of gene expression by nuclear hormone receptors and possibly
other transcriptional regulators.
 |
MATERIALS AND METHODS |
Plasmids and antibodies.
pGEX2T-mRXR
expressing the
full-length murine receptor fused to GST was provided by Paul T. van
der Saag (22). Deletion mutants of mRXR
were
constructed by PCR amplification of mRXR
using a 5' primer
containing a BgIII site linked to the first codon of mRXR
and a 3' primer containing a stop codon and an EcoRI site.
The BgIII-EcoRI digest of the PCR products were
cloned into BamHI-EcoRI-digested pGEX2T.
Different deletion mutants of cTR
fused to GST were described
previously (18).
pEBG, a mammalian GST expression vector, was used to express GST
fusions of receptors in 293T cells (59, 75). cTR
(amino acids 1 to 408) was excised from pGEX2T-cTR
with BamHI
and cloned into the BamHI site of pEBG. mRXR
was removed
from pGEX2T-mRXR
by complete digestion with AvrII and
partial digestion with BamHI. The AvrII site is
present just after the mRXR
stop codon. The gel-purified 1.5-kb
fragment was then cloned into BamHI-SpeI site of pEBG.
Gal4-PSF-A (amino acids 1 to 707) was constructed by excising
full-length PSF-A from a pET-PSF-A vector with NdeI and
XhoI, blunt ending the NdeI-XhoI
fragment with Klenow enzyme, and ligating it to SmaI-cut and
dephosphorylated pSG424 (66). The various Gal4-PSF-A
deletion mutants were constructed by PCR using primers containing a
BamHI site at the 5' end and a SacI site at the
3' end. The PCR products were purified, digested with BamHI
and SacI, and cloned into the
BamHI-SacI sites of pSG424. Gal4-RXR(1-450)-VP16 and Gal4-RXR LBD(206-450)-VP16 were constructed by PCR amplification of
mRXR
and cloning the sequences encoding amino acids 1 to 450 or 206 to 450 between Gal4 and VP16. Full-length PSF-A was cloned into
pcDNA3.1(+) after excising PSF-A from pGEX4T1-PSF-A by partial digestion with EcoRI. The 2.2-kb fragment was gel
purified and cloned into EcoRI site of pcDNA3.1(+).
Similarly, NonO was cloned into pSG424 as well as pcDNA3.1(+).
In vitro 35S labeling of PSF-A and NonO cloned in
pcDNA3.1(+) was carried out using coupled in vitro
transcription-translation with T7 polymerase and rabbit reticulocyte
lysates. Similarly, 35S-cTR
was expressed from a pEX
vector using T7 polymerase (25). The GST-SMRT and
GST-Sin3A clones (83) used in our study were obtained from
Martin Privalsky, University of California, Davis. Antibodies against
Sin3A (K-20) and GST were purchased from Santa Cruz Biotechnology, Inc.
PSF and NonO antibodies were developed in the P. W. Tucker
laboratory, University of Texas, Austin, and TLS antibodies were from
David Ron, NYU School of Medicine. Other PSF antibody was from James G. Patton, Vanderbilt University. Antibodies directed against N-CoR was a
gift from Mitchell Lazar, University of Pennsylvania School of Medicine.
Preparation of GST fusion proteins.
For the preparation of
GST fusion proteins in Escherichia coli, 5 ml of overnight
cultures were diluted 100 times and grown further for about 4 h.
This culture was induced with 1 mM
isopropyl-
-D-thiogalactopyranoside for about 1 h at
37°C and then chilled at 4°C for 10 min before pelleting of the
bacteria. The cell pellet from each 500-ml culture was resuspended in
20 ml of phosphate-buffered saline (PBS) containing EDTA (50 mM, pH
8.0), dithiothreitol (DTT; 1 mM), leupeptin (20 µg/ml) and pepstatin
(20 µg/ml). The bacteria were then incubated with lysozyme (1 mg/ml)
for 10 min on ice, and the cells were disrupted using a sonicator. The
bacterial suspension was centrifuged, and the supernatant was incubated
with 500 µl of a 50% slurry of glutathione-agarose beads for 30 min.
The beads were then washed in PBS three times (the last wash contained
50 µM ZnCl2 and 2 mM DTT), suspended in 250 µl of PBS
containing 50 µM ZnCl2, 2 mM DTT, and 50% glycerol, and
stored at
20°C. The addition of 50 µM ZnCl2 and 2 mM
DTT was only for the GST-receptor preparations.
Preparation of nuclear extracts.
Nuclear extracts were
prepared from HeLa cells by the method described by Dignam et al.
(20). The final extract was dialyzed overnight at 4°C in
a mixture of 20 mM HEPES (pH 7.8), 20% glycerol, 0.1 M KCl, 0.2 mM
EDTA, 0.5 mM DTT, phenylmethylsulfonyl fluoride. The dialyzed nuclear
fraction was centrifuged at 10,000 rpm to remove any precipitate and
then stored at
80°C in aliquots. The protein concentration of
dialyzed nuclear extract ranged between 3 and 5 mg/ml. The samples were
used for GST-receptor binding studies or for immunoprecipitation.
Purification and sequencing of p100 and p55.
To isolate p100
and p55 for sequencing, the nuclear extracts were first partially
purified on DEAE-Sephadex columns as previously described
(59). Nuclear extract (~4 mg of protein) was diluted with DEAE buffer (20 mM Tris-C1 [pH 7.8], 10% glycerol, 2 mM DTT, 100 mM KCl) in a 1:1 ratio and passed through a 1-ml packed column of
DEAE-Sephadex equilibrated in the same buffer. The flowthrough was
collected and combined with the eluted fraction (2 bed volumes eluted
with buffer containing 100 mM KCl) of the column. The samples were then
incubated in the elution buffer for 30 min to 1 h at 4°C with 1 µg of GST-mRXR
(140-240), and the bound proteins were then
analyzed by electrophoresis in sodium dodecyl sulfate (SDS)-gels. The
proteins in the gel were transferred to nitrocellulose and visualized
by staining with Ponceau S. The protein bands of interest (p100 and
p55) were cut out, eluted, and cleaved with endoproteinase Glu-C.
Peptide fragments were isolated by high-pressure liquid chromatography
followed by automated sequence analysis.
In vitro protein binding assays.
The nuclear extract was
diluted with an equal volume of protein binding buffer (20 mM HEPES
[pH 7.8], 1 mM MgCl2; 10 µM ZnCl2, 2 mM
DTT, 10% glycerol, 0.05% Triton X-100, 40 µg of leupeptin/ml, 100 mM KCl) and centrifuged for 10 min. The supernatant was incubated with
equal amounts of GST fusion proteins for 1 h at 4°C, and the
beads were then washed three times with the same buffer. The beads were
suspended in an equal volume of 2× SDS sample buffer and boiled, and
the eluted proteins were analyzed by electrophoresis in SDS gels. About
300-ng aliquots of GST fusion proteins were used for Western blotting
or for studies with 35S-labeled proteins. In one
experiment, nuclear extract was incubated with GST-RXR(140-240) in the
absence or presence of a 5- and 10-fold molar excess of a duplex
oligonucleotide containing a high-affinity hormone response element
recognition sequence (HRE) for RXR or TR (AGGTCA TGACCT) or
an oligonucleotide containing a G
C change (HREm) which has no
affinity for receptors (ACGTCA TGACGT
[changed nucleotides are underlined]) (24). The
exact sequences of the oligonucleotides were (AGCTT AGGTCA TGACCT
AAGCT) for the HRE and (AGCTT ACGTCA
TGACGT AAGCT) for the HREm. For Western blotting, the
bound proteins were transferred to nitrocellulose in Tris-glycine buffer containing 20% methanol and 0.1% SDS at a constant voltage of
40 V over a period of 8 to 10 h at 4°C. The membranes were blocked in 10% milk and then probed with the antibody of interest. The
immunoreactive bands were detected by using the Super Signal chemiluminescence system from Pierce and an appropriate second antibody
linked to peroxidase. For protein binding assays using 35S-protein labeled in vitro, the reticulocyte lysates were
incubated in protein binding buffer containing RNase A (15 µg/ml) at
room temperature for 15 min. GST fusion proteins bound to
glutathione-agarose beads were added, and the samples were incubated
for an additional h at 4°C. The beads were washed three times with
protein binding buffer, and the bound proteins were analyzed by
electrophoresis in SDS-gels followed by autoradiography.
Immunoprecepitation.
HeLa nuclear extract (~200 µg of
protein) was diluted with an equal volume of buffer (20 mM HEPES [pH
7.8], 1 mM MgCl2, 10% glycerol, 0.05% Triton X-100, 100 mM KCl, 40 µg each of leupeptin, pepstatin, and antipain per ml). The
buffered extract was precleared by incubation with protein A-Sepharose
followed by centrifugation before incubating the extract with antibody
for immunoprecipitation. The antibody-associated proteins were then
bound to protein A-Sepharose beads and washed three times in the same
buffer. The samples were then fractionated in SDS-8% PAGE gels
followed by Western blotting with the antibody of interest. The blots
were developed using the Pierce Super Signal chemiluminescence system.
Cell culture and transfection.
For chloramphenicol
acetyltransferase (CAT) assay studies in 293T cells, the cells were
transfected with 1 µg of the
MTV-HRE-CAT reporter gene
(24) along with vectors expressing cTR
and/or PSF-A or
NonO. After incubation for 48 h with or without T3, the cells were
harvested for assay of CAT activity. Similar transfection studies were
also carried out in HeLa cells with the Gal4 reporters, G5pBLCat2
(61) or pMC110 (65), and Gal4 fusions of
PSF-A and NonO or the Ga14-VP16 chimeras of RXR. These CAT reporter
experiments were performed several times with duplicate or triplicate
samples. The experiments shown are representative studies which were
repeated at least three times with similar results. For in vivo
protein-protein interaction assays, 293T cells were transfected with
pEBG, pEBG-mRXR
, or pEBG-cTR
. Forty-eight hours after
transfection, ligand was added to the medium for 2 h before
harvesting the cells, and the nuclear extracts were prepared by the
method of Dignam et al. (20). Nuclear extracts expressing
equivalent amounts of GST protein (determined by Western blotting with
antibody against GST) were incubated with glutathione-agarose beads for
1 h at 4°C. The bound proteins were then analyzed by
electrophoresis in SDS-gels followed by Western blotting using antibody
against the protein of interest.
 |
RESULTS |
The association of PSF and NonO/p54nrb with
TR and RXR requires the receptor DBD.
We previously reported that
the DBDs of TR and RXR are required for the in vitro binding of a
~65-kDa nuclear protein, which we identified as TLS, and two other
nuclear proteins (~100 and ~55 kDa) (59). Figure
1 illustrates the domain structure of mRXR
and the association of HeLa cell nuclear extract proteins with
different domains of mRXR
(amino acids 1 to 239, 140 to 240, 140 to
467, and 206 to 467) expressed as GST fusion proteins. TLS (p65) and
the p100 and p55 proteins bind to only those fusion proteins containing
the mRXR
DBD (amino acids 140 to 205) (Fig. 1B). A less abundant
protein which migrates just above the 100-kDa protein was also
identified in the experiment in Fig. 1 but is not consistently found in
all experiments. Most of the other proteins in the gel, other than the
predominant GST fusion protein, are not derived from the nuclear
extract since, as previously described, they are also found after
electrophoresis of the GST fusion protein preparation
(59). In a previous study we found that a high-affinity HRE (AGGTCA TGACCT) binding sequence for TR and RXR did not
interfere with the association of TLS with TR (59). Figure
1C illustrates that a 10-fold molar excess of the HRE over GST-RXR
(140-240) does not inhibit the binding of TLS (p65), p55, or p100,
suggesting that these proteins bind to the DBD independent of DNA
binding. Incubation with RNase did not affect the binding of TLS, p55, or p100 to RXR(140-240) (59), suggesting that RNA does
not play a role in the binding of these proteins to RXR(140-240).

View larger version (49K):
[in this window]
[in a new window]
|
FIG. 1.
The binding of p100 and p55 to mRXR requires the
receptor DBD region. (A) mRXR structural domains. (B) Different
regions of mRXR , expressed in E. coli as GST fusion
proteins and bound to glutathione-agarose beads, were incubated with
partially purified HeLa cell nuclear extracts. The proteins binding to
different regions of mRXR were analyzed by SDS-gel electrophoresis
and staining the gel with Coomassie brilliant blue. Three prominent
proteins p100, p65, and p55 (arrows) were identified to associate with
the GST-RXR fusion proteins containing the mRXR DBD (amino acids 140 to 205) but not with GST-RXR expressing only the LBD (amino acids 206 to 467). p65 was previously identified as TLS (59). (C)
GST-RXR(140-240), bound to glutathione-agarose, was initially
incubated at 4°C without ( ) or with a high-affinity RXR and TR HRE
(H) or a mutant control sequence, HREm (M), which does not bind
receptors. One milliliter of partially purified HeLa cell nuclear
extracts was then added, and the samples were further incubated for
1 h. The concentration of GST-RXR(140-240) was 50 nM, while those
of the oligonucleotides were 250 and 500 nM as indicated. The beads
were washed and electrophoresed, and the gel was stained with Coomassie
brilliant blue. The HRE does not affect the association of p55, p65, or
p100 with GST-RXR.
|
|
For large-scale purification of p100 and p55, the proteins which bound
to GST-mRXR
(140-240) were transferred to nitrocellulose (hereafter,
mRXR
is referred to as RXR). The proteins of interest were detected
by Ponceau S staining, eluted, and sequenced. The sequence of the
derived peptides indicated that p100 is PSF-A (58) and p55
is NonO/p54nrb (21, 85) (Fig.
2). For p100, several overlapping
peptides matched exactly with the sequence of PSF-A from amino acid
residues 300 to 700. No peptides specific for PSF-F were detected. PSF isoforms of 76 and 72 kDa have been reported (58) and are
designated as PSF-A and PSF-F, respectively (Fig. 2A). These two
isoforms are identical through amino acid 662 but thereafter diverge,
with PSF-F containing 669 amino acids and PSF-A containing 707 amino acids (58). PSF contains two RRMs (RRMs I and II, amino
acids 298 to 464) and an unusual N-terminal region rich in proline and glutamine residues and appears to migrate anomalously as a ~100-kDa protein in SDS-gels.

View larger version (23K):
[in this window]
[in a new window]
|
FIG. 2.
p100 is PSF-A, and p55 is
NonO/p54nrb. (A) Domain structures of PSF-A and
PSF-F. p100 was identified as PSF-A, a 707-amino-acid protein with two
predicted RNA binding domains (RRM I and RRM II) and other regions
enriched for proline (P) or proline and glutamine (P, Q). The sequence
of several overlapping peptides, obtained after digestion of purified
p100, spanned amino acids 300 to 700 and matched the known sequence of
PSF-A. PSF-F (669 amino acids), a shorter spliced version of PSF-A, is
identical up to amino acid 662 of PSF-A and then diverges with only
seven additional amino acids at the C-terminal end (VRMIDVG). (B)
Structure of NonO/p54nrb.
NonO/p54nrb is a 473-amino-acid protein with a
number of structural features indicated in the diagram. Two peptide
sequences obtained after digestion of purified p55 exactly matched a
sequence in the RRM II domain and the proline-rich region at the C
terminus of NonO/p54nrb.
|
|
Two peptide sequences obtained from purified p55 confirmed that the
protein is NonO/p54nrb. One peptide sequence was
within one of the NonO/p54nrb RRMs (amino acids
154 to 170), and the other was within the C-terminal proline rich
region (amino acids 399 to 415) (Fig. 2B).
NonO/p54nrb is a nuclear DNA and RNA-binding
protein of 473 amino acids (21, 85). PSF and
NonO/p54nrb are closely related proteins with
over 70% identity in an internal 320-amino-acid region (amino acids 54 to 374 of NonO/p54nrb and amino acids 277 to 597 of PSF) containing two consensus RRMs. The function of
NonO/p54nrb is unknown. However,
NonO/p54nrb has been reported to bind to and
enhance the in vitro transcription of an intracisternal A particle
proximal enhancer element-driven reporter gene (4) as well
as the DNA binding of Oct2 and E47 to their cognate sites
(86).
PSF and NonO/p54nrb exist as monomers and
as higher-molecular-weight protein complexes.
To investigate
possible interactions of TLS, PSF, and
NonO/p54nrb, nuclear protein extracts of HeLa
cells were partially purified on DEAE-Sephadex and then subjected to
size exclusion fast protein liquid chromatography (FPLC) using a
Superose 6 column. As shown in Fig. 3,
NonO/p54nrb (~55 kDa) and PSF (~72 kDa)
elute as free proteins and as part of a larger complex(es) (~100 to
300 kDa), which is consistent with the notion that these proteins may
exist as a heterotetrameric complex in the cell (91).
Whether the ~100- to 300-kDa complex identified by FPLC consists of
just PSF and NonO/p54nrb or includes other
proteins was not determined. However, we show later (see Fig. 9 and 10)
that PSF can interact with Sin3A. In contrast with PSF and
NonO/p54nrb, TLS elutes only as a monomer and is
not a component of a higher-molecular-weight complex with PSF or
NonO/p54nrb.

View larger version (23K):
[in this window]
[in a new window]
|
FIG. 3.
PSF and NonO/p54nrb exist as
monomers and as higher-molecular-weight protein complexes. Partially
purified HeLa nuclear extract (N.E.) was fractionated with a Superose 6 FPLC column to study the elution profile of TLS, PSF, and
NonO/p54nrb. Each fraction (indicated by numbers
above the lanes) was concentrated and analyzed by Western blotting with
antibodies against TLS, PSF, and NonO. TLS elutes in a pattern
consistent with its size, while PSF and
NonO/p54nrb elute both as part of a larger
complex in addition to apparent free uncomplexed forms.
NonO/p54nrb elutes as ~55 kDa while PSF elutes
at ~80 kDa, sizes which are predicted by their amino acid sequences
(PSF migrates anomalously as ~100 kDa in SDS-gels).
|
|
Physical and functional interaction of PSF-A with TR and RXR.
To study the physical interaction of receptors and PSF, we first
carried out binding studies using GST fusions of full-length cTR
(hereafter, cTR
is referred to as TR) and full-length RXR expressed
in bacteria and 35S-labeled PSF-A synthesized with
reticulocyte lysates. As shown in Fig.
4A, PSF-A binds to GST-RXR and GST-TR but
not to GST alone, suggesting a direct interaction of PSF-A and these
receptors. In contrast, 35S-labeled NonO does not bind
directly to GST-TR or GST-RXR (Fig. 4B), suggesting that the apparent
association of NonO/p54nrb with the receptors
likely results from its interaction with receptor-bound PSF-A.

View larger version (37K):
[in this window]
[in a new window]
|
FIG. 4.
In vitro binding of 35S-labeled PSF-A
to full-length GST-TR and GST-RXR. PSF-A and NonO were
synthesized in vitro using rabbit reticulocyte lysates and radiolabeled
with [35S]methionine. (A) Equal amounts of
35S-PSF-A were incubated with different GST proteins
(~300 ng) bound to glutathione-agarose beads. PSF-A binds to GST-TR
and GST-RXR but not to GST alone. (B) In contrast with the findings for
35S-PSF-A, 35S-NonO does not bind to full
length GST-TR or GST-RXR.
|
|
Several approaches were also undertaken to provide support for in vivo
interactions of PSF with TR and RXR. Full-length TR and RXR were cloned
into a GST mammalian expression vector (pEBG) (59, 75) and
transfected into 293T cells. These GST-receptor chimeras are
biologically active and lead to ligand-dependent transcriptional
activation in transfection experiments (not shown). For analysis of
receptor-PSF interactions, nuclear extracts were prepared from cells
transfected with pEBG alone, pEBG-TR, or pEBG-RXR. Nuclear extracts
expressing equivalent amounts of GST or GST fusion proteins (determined
by Western blotting with antibody against GST) were incubated with
glutathione-agarose beads for 1 h, washed, and analyzed by Western
blotting for PSF (Fig. 5A). PSF appears to electrophorese as a broad, partially resolved doublet, although a
very short autoradiographic exposure shows two distinct bands. The size
of these bands are consistent with the proteins being PSF-A and PSF-F,
although we cannot exclude the possibility that the
lower-molecular-weight species is a degradation product of PSF-A.
Assuming that the proteins detected by Western blot are PSF-A and
PSF-F, only PSF-A appears to bind to GST-TR and GST-RXR (Fig. 5A),
which is consistent with our peptide sequencing results. The C-terminal
amino acids present in PSF-A and not in PSF-F are TERFGQGGAGPVGGQGPRGMGPGTPAGYGRGREEYEGPNKKPRF. This region,
which is outside the RRM and is glycine rich (30%), appears to be
important for the interaction of PSF-A with the receptors. Thus, the
RNA binding and receptor binding functions of PSF appear to reside in
two separate domains of PSF-A.

View larger version (20K):
[in this window]
[in a new window]
|
FIG. 5.
RXR and TR selectively bind PSF-A. (A) 293T cells were
transfected with the mammalian GST expression vector pEBG alone or pEBG
expressing full-length TR or RXR. Nuclear extracts expressing
equivalent amounts of GST, GST-RXR, or GST-TR were incubated with
glutathione-agarose beads. The bound proteins were then analyzed by
Western blotting with anti-PSF antibody. In this experiment, the gel
was electrophoresed for a longer time than normal. Under these
conditions, PSF electrophoreses as a broad, partially resolved doublet,
although a very short autoradiographic exposure shows two distinct
bands. The size of these bands are consistent with the proteins being
PSF-A and PSF-F. Since we cannot precisely determine whether the
lower-molecular-weight species is PSF-F or a degradation product of
PSF-A, we have indicated the band with a ?. Although both forms are
present in the nuclear extract (N.E.), only PSF-A binds to the
receptors. (B and C) PSF-A binding to RXR and TR involves the DBDs of
the receptors. An equal amount of HeLa nuclear extract (500 µg) was
incubated with equimolar amounts of bacterial expressed GST fusion
proteins containing different regions of RXR or TR as indicated. The
glutathione-agarose beads were washed, and the bound proteins were
analyzed by Western blotting with anti-PSF antibody. PSF-A binds only
to the GST-receptor fusion proteins which contain the DBD of RXR or TR.
The LBDs of RXR(206-467) and TR(120-408) do not bind PSF-A.
|
|
To further analyze the regions of TR and RXR involved in the
association of endogenous HeLa cell PSF-A, in vitro binding studies were performed with various deletion mutants of TR and RXR expressed as
GST fusion proteins in bacteria. Equimolar amounts of GST fusion proteins were incubated with HeLa nuclear extracts (500 µg of protein), and the association of PSF was determined by Western blotting
with anti-PSF antibody. As shown in Fig. 5B, PSF-A binds to GST-RXRs
(amino acids 1 to 239, 140 to 240, and 140 to 467) containing the RXR
DBD (amino acids 140 to 205) but not to the RXR LBD alone (amino acids
206 to 467). Similar results were also found for TR (Fig. 5C). PSF-A
binds to GST-TRs containing amino acids 1 to 119, 1 to 151 and 1 to 408 (full length), which each include the TR DBD (amino acids 51 to 119),
but not to amino acids 120 to 408, which contain only the TR LBD. These
results confirmed our previous observations (Fig. 1) indicating that
the binding of PSF-A to TR and RXR involves their DBDs whereas the LBDs
of the receptors do not interact with PSF-A.
To provide evidence for a functional in vivo interaction of TR with
PSF-A, HeLa cells were transfected with a Gal4-responsive thymidine
kinase-CAT reporter (G5pBLCat2) along with vectors expressing Gal4
fused to full-length PSF-A (Gal4-PSF-A) or to the C-terminal region of
PSF-A (Gal4-cPSF-A, amino acids 464 to 707) and/or a cTR
construct
(TR-VP16, amino acids 1 to 221). This TR-VP16 does not bind ligand but
contains the DBD (amino acids 51 to 119) along with the 50-amino-acid
N-terminal A/B domain of TR
and about 100 amino acids of the LBD
fused to the transactivation domain of VP16. Since this TR-VP16 has
very little of the LBD, it would not be expected to bind to
corepressors such as N-CoR or SMRT. The expectation of this study was
that if TR-VP16 interacted with Gal4-PSF-A or GAL4-cPSF-A, this would
lead to increased activation of G5pBLCat2 when the Gal4-PSF-A fusions
were expressed with TR-VP16. Surprisingly, we found that the expression
of Gal4-PSF-A resulted in a four- to five-fold repression of the CAT
reporter gene (Fig. 6), while expression
of Gal4-cPSF-A resulted in a threefold increase. This weak activation
function of Gal4-cPSF-A appears to be repressed in the context of
full-length PSF-A in Gal4-PSF-A, suggesting that the N-terminal half
of PSF harbors a repression domain.

View larger version (18K):
[in this window]
[in a new window]
|
FIG. 6.
In vivo interaction of TR with the C-terminal domain of
PSF-A (cPSF-A). HeLa cells were transfected with a CAT reporter
(G5pBLCat2) with the Gal4 DBD or Gal4 DBD fusion of full-length PSF-A
or the C-terminal region of PSF-A (amino acids 464 to 707) (cPSF-A)
with or without TR-VP16 (amino acids 1 to 221 of TR fused to the VP16
activation domain). Gal4-cPSF-A exhibits a threefold increase in
activity compared to Gal4 alone, and its interaction with TR is evident
by further activation after expression of TR-VP16. In contrast,
expression of Gal4-PSF-A (full length) leads to repression compared to
Gal4 alone or when expressed with TR-VP16.
|
|
Expression of TR-VP16 with Gal4-cPSF-A further enhanced the extent of
activation, providing additional support for an in vivo interaction
between the truncated TR-VP16 protein and the C-terminal region of
PSF-A. However, the repressor activity of full-length PSF-A in
Gal4-PSF-A completely masks the activation function of TR-VP16. We did
not observe the same extent of repression by Gal4-PSF-A on a Gal4-CAT
reporter gene regulated by the simian virus 40 early promoter
(G5pSV-Cat) as opposed to G5pBLCat2, indicating that promoter context
may play a role in repression, possibly resulting from differences in
the transcription factors that bind specifically to these promoters. In
similar experiments with G5pBLCat2, Gal4-NonO (full length), which is
70% identical in RRM II, also resulted in repression. However, the
extent of repression was less (~1.5- to 2-fold inhibition) than with
Gal4-PSF-A, although Western blotting using Gal4 DBD antibody
indicated that Gal4-NonO was expressed at similar levels as Gal4-PSF-A
(not shown).
PSF-A enhances TR-mediated repression in the absence of
ligand.
Since Gal4-PSF-A exhibits repressor activity, we sought
to study the effect of PSF-A on wild-type TR activity in mammalian cells. To study the effect of PSF-A on the repressive function of TR,
transfection studies were performed with 293T cells (Fig. 7), where we found that expression of
unliganded TR does not lead to as much repression as in other cell
types. The reason for this is unclear. Nevertheless, this gave us the
opportunity to examine whether expression of PSF-A can lead to
repression in this system. Transfection studies were performed with
pcDNA vectors expressing full-length PSF-A along with full-length
cTR
in the presence or absence of T3. Since PSF-A is a moderately
abundant protein, cells were transfected with 30 µg of PSF-A
expression vector to express this protein at a level higher than the
endogenous amount. In this study, expression of PSF-A with TR resulted
in a fourfold enhancement in the level of repression compared to
unliganded receptor alone. However, expression of PSF-A alone had
little or no effect on the basal activity of the reporter. These
studies suggest that PSF-A enhances promoter repression through
interaction with unliganded receptor.

View larger version (40K):
[in this window]
[in a new window]
|
FIG. 7.
PSF-A enhances the extent of transcriptional repression
by unliganded TR. 293T cells were cotransfected with the MTV-HRE-CAT
reporter and with vectors expressing full-length PSF-A and/or cTR
with or without T3. PSF-A represses the basal activity of the CAT
reporter only when the receptor is expressed in the absence of hormone,
suggesting that it enhances the gene silencing effect of unliganded TR.
PSF-A alone had no effect on the basal activity of MTV-HRE-CAT.
|
|
The repressor activity of PSF-A resides in the N-terminal half of
the protein.
The Gal4-PSF-A and Gal4-cPSF-A results in Fig. 6
suggest that the repressor activity of PSF-A resides in the N-terminal
region of the protein (amino acids 1 to 464). To further specify the domain(s) of PSF-A necessary for repression, a series of Gal4-PSF-A chimeras spanning different regions in the N terminus of PSF-A were
created by PCR. These Gal4-PSF-A chimeras were found to express correctly and at similar levels as determined by Western blotting using
antibody against the Gal4 DBD (data not shown). As shown in Fig.
8, the repressor activity of PSF-A
requires residues containing RRM II of PSF-A (amino acids 361 to 464).

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 8.
The repressor activity of PSF-A requires amino acids 361 to 464 of the protein. PSF-A deletion mutants, created by PCR, spanning
various regions of the N-terminal domain of PSF-A (amino acids 1 to
464) were cloned as Gal4 fusion constructs. The region mediating the
repressor activity of PSF-A was functionally mapped by transfection
studies using the G5pBLCat2 reporter in HeLa cells.
|
|
PSF-A directly associates with Sin3A.
Since a number of
factors are thought to mediate repression through interaction with
Sin3A (31, 41, 43, 54), we examined whether Sin3A
associates with PSF. HeLa nuclear extracts were immunoprecipitated with
anti-Sin3A antibody followed by Western blotting for PSF. As shown in
Fig. 9, PSF is immunoprecipitated by
antibodies against Sin3A, suggesting that PSF and Sin3A associate directly or indirectly in vivo. To provide evidence for a direct interaction of Sin3A and PSF, we first constructed GST fusions of
PSF-A. However, we found that GST-PSF-A proteins are poorly expressed
in E. coli, and thus we examined for an association of Sin3A
with PSF-A using GST-mSin3A proteins (83) and
35S-PSF-A. As shown in Fig.
10, 35S-PSF-A binds to
amino acids 404 to 545 of mSin3A, a region encompassing the paired
ampipathic helix PAH2 and PAH3 domains (81, 83). GST-Sin3A
binding studies were also performed using 35S-NonO.
Although NonO/p54nrb and PSF share 70%
structural identity over a 320-amino-acid region residing in their
RRMs, NonO/p54nrb does not bind to Sin3A in our
in vitro binding assays (data not presented). This suggests that the
lower level of repression seen with Gal4-NonO may be mediated through
its ability to form a complex with PSF (91). However, the
role of NonO/p54nrb in mediating repression by
PSF-A is unclear.

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 9.
PSF immunoprecipitates with Sin3A. Nuclear extracts
prepared from HeLa cells were immunoprecipitated with anti-Sin3A
antibody or preimmune serum, and the samples were then analyzed by
Western blotting with anti-PSF antibody. N.E., nuclear extract; Sin3A
IP, immunoprecipitation with Sin3A antibody; Control IP,
immunoprecipitation with preimmune serum.
|
|

View larger version (21K):
[in this window]
[in a new window]
|
FIG. 10.
PSF-A interacts with Sin3A in vitro. Different domains
of Sin3A were expressed as GST-fusion proteins in E. coli.
Equivalent amounts of these fusion proteins were incubated with in
vitro-synthesized 35S-PSF-A. The glutathione-agarose beads
were washed and the bound 35S-PSF-A analyzed by SDS-gel
electrophoresis followed by autoradiography. PSF-A binds to the region
of Sin3A (amino acids 404 to 545) between the PAH2 and PAH3 domains.
|
|
Association of Sin3A with TR and RXR involves the receptor DBD
regions.
Since PSF-A interacts with Sin3A, we examined whether
Sin3A associates with the same regions of RXR and TR that interacts with PSF-A. HeLa cell nuclear extracts were incubated in vitro with GST
fusions of RXR and TR as described earlier for PSF-A (Fig. 5), followed
by Western blotting with antibodies against Sin3A (Fig.
11). Sin3A associates with GST-RXRs
(amino acids 1 to 239, 140 to 240, and 140 to 467) which contain the
DBD (amino acids 140 to 205) but does not associate with only the LBD
(amino acids 206 to 467) (Fig. 11A). Thus, the pattern of binding of
Sin3A with the GST-RXRs is identical to that found for the binding of PSF-A (Fig. 5B), suggesting that Sin3A binds to RXR through an association with PSF-A. The pattern of binding of Sin3A with the GST-TRs (Fig. 11B) was generally similar but showed some differences from that for PSF-A (Fig. 5C). Sin3A associated with GST-TRs expressing amino acids 1 to 151 which contains the A/B domain (amino acids 1 to
50), the DBD (amino acids 51 to 119), and part of the hinge region
(amino acids 120 to 151). GST-TR(1-119) bound less Sin3A than
GST-TR(1-151) and somewhat less but detectable binding was found with
GST-TR(120-408) containing the LBD.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 11.
Efficient binding of Sin3A to RXR and TR involves the
DBD and the proximal hinge (D) region of the receptors. HeLa nuclear
extracts were incubated with GST proteins expressing different domains
of RXR or TR. The bound proteins were analyzed by Western blotting
using anti-Sin3A antibody. (A) Sin3A binds to GST-fusion proteins
expressing the RXR DBD but not the RXR LBD (amino acids 206 to 467).
(B) Sin3A binds efficiently to GST-TR (full length) and to
GST-TR(1-151) (which include the DBD and the proximal hinge region)
but much less efficiently to GST-TR(1-119) (lacking the hinge region)
and to GST expressing only the LBD [GST-TR(120-408)]. N.E, nuclear
extract.
|
|
These findings imply that the association of Sin3A requires the
receptor DBD as well as the N-terminal part of the hinge region. Thus,
both the DBD and the hinge region (the proximal part of the hinge
region is thought to participate in DNA binding and thus may be
considered as part of the DBD as well as the LBD) appear to participate
in high-affinity binding of Sin3A to receptors, possibly through its
association with PSF-A. Since SMRT and N-CoR have been reported to
associate with Sin3A in vitro, we considered the possibility that such
corepressors might also interact with PSF-A and thus recruit Sin3A to
the receptor DBD region. To explore this, in vitro binding studies were
carried out with 35S-PSF-A and GST-SMRT fusions
encompassing different domains of SMRT (Fig.
12A). 35S-PSF-A did not
bind to any of the GST-SMRT proteins, although GST-SMRT (amino acids
1055 to 1291) and GST-SMRT (amino acids 1291 to 1495) bound
35S-TR, which served as a positive control (Fig. 12B).

View larger version (48K):
[in this window]
[in a new window]
|
FIG. 12.
PSF-A does not interact directly with SMRT. Different
domains of SMRT, expressed as GST fusion proteins in E. coli, were incubated with in vitro-synthesized
35S-PSF-A. The samples were then analyzed by
electrophoresis followed by autoradiography. In the glutathione
control, samples were incubated with glutathione-agarose (GSH) beads
without bound GST protein. (A) PSF-A does not bind to any of the
GST-SMRT fusion proteins, while 35S-PSF-A binds to GST-NonO
(positive control). (B) The GST-SMRT proteins which do not bind PSF-A
bind 35S-cTR (positive control). As previously described
(83), the C-terminal domain of SMRT (amino acids 1291 to
1495 and amino acids 1055 to 1291) strongly interacts with TR.
|
|
Transcriptional repression mediated by PSF-A involves HDAC
activity.
Since PSF-A associates with Sin3A, and Sin3A interacts
with class I HDACs, we examined if sodium butyrate, an inhibitor of HDACs (70), can reverse the repression mediated by PSF-A.
Sodium butyrate was used instead of the HDAC inhibitor trichostatin A (89) because we found that trichostatin A, at
concentrations which inhibit HDACs, is toxic in HeLa cells. HeLa cells
were transfected with G5pBLCat2 along with a vector expressing
Gal4-PSF-A (full length) or the Gal4 DBD alone. Sodium butyrate was
initially tested over a concentration range of 0.5 to 2.5 mM.
Concentrations of sodium butyrate greater than 1 mM inhibited cell
growth. Thus, we used two concentrations of sodium butyrate (0.4 and
0.6 mM). As shown in Fig. 13,
expression of Gal4-PSF-A leads to a fivefold inhibition of
transcriptional activity. However, addition of 0.4 and 0.6 mM sodium
butyrate reversed this repression 1.5- and 3-fold, respectively, while
having no effect on cells expressing only the Gal4 DBD. These findings
suggest that histone deacetylation plays a role in the repressor
activity of PSF and provide support for a model where PSF-A mediates
repression through the recruitment of a Sin3A-HDAC complex.

View larger version (43K):
[in this window]
[in a new window]
|
FIG. 13.
Effect of sodium butyrate on PSF-A-mediated
transcriptional repression. HeLa cells were transfected with equimolar
quantities of vector expressing the Gal4 DBD or Gal4-PSF-A (full
length) with the G5pBLCat2 reporter. The cells were then incubated
without or with either 0.4 or 0.6 mM sodium butyrate for 48 h
before harvesting of cells for assay of CAT activity.
|
|
PSF-A and Sin3A do not dissociate from ligand-bound TR or RXR in
vivo.
To test for possible in vivo interactions of PSF and Sin3A,
and the role of ligand on their binding to receptors, pEBG vectors expressing GST, GST-TR (full length), or GST-RXR (full length) were
transiently expressed in 293T cells. Forty-eight hours after transfection, the cells were incubated without or with T3 or
9-cis RA for 2 h prior to harvesting. Nuclear extracts
containing equivalent amounts of GST, GST-TR, or GST-RXR (determined by
Western blotting with antibody against GST) were incubated with
glutathione-agarose beads followed by Western blotting with antibodies
against PSF, Sin3A, and N-CoR.
PSF-A and Sin3A bound to both TR and RXR, and this association was not
affected by incubation with T3 or 9-cis RA (Fig.
14). N-CoR bound to unliganded TR, and
this association was completely reversed by T3 incubation (Fig. 14A).
N-CoR was not detected to associate with RXR either in the presence or
absence of ligand (Fig. 14B), which is consistent with the notion that
the LBD of RXR exhibits very low levels of repressor activity
(61). The finding that ligand did not alter the binding of
Sin3A to TR in vivo was surprising since Sin3A has been reported to
bind to N-CoR/SMRT in vitro. However, this finding is consistent with
our in vitro binding studies indicating that the association of Sin3A
with TR and RXR does not require the LBD of these receptors. This
finding is also consistent with recent studies indicating that
N-CoR/SMRT may mediate repression via a direct interaction with class
II HDACs (36, 40).

View larger version (14K):
[in this window]
[in a new window]
|
FIG. 14.
PSF-A and Sin3A remain bound to TR and RXR in the
presence of ligand. GST-TR and GST-RXR expressing full-length receptors
or GST alone were transiently expressed in 293T cells. Forty-eight
hours after transfection, the cells were incubated with T3 or
9-cis RA for 2 h before harvesting of cells for
preparation of nuclear extracts. Nuclear extracts expressing equivalent
amounts of GST-TR, GST-RXR, or GST were incubated with
glutathione-agarose beads, washed, and then analyzed for the
association of PSF, Sin3A, or N-CoR by Western blotting. PSF-A and
Sin3A remain associated with TR or RXR in the presence or absence of
ligand (A and B). N-CoR associates with TR only in the absence of
ligand (A), while N-CoR does not interact with RXR in the presence or
absence of ligand (B). N.E., aliquot of nuclear extract which was not
incubated with glutathione-agarose.
|
|
The DBD and PSF mediate transcriptional repression in vivo.
The finding that unliganded RXR does not bind N-CoR, while it
associates with PSF-A and Sin3A through the DBD, allowed us to design
experiments to (i) functionally assess the importance of this
interaction in vivo and (ii) examine the possibility that the
association of Sin3A with RXR occurs via an interaction with PSF-A. Our
previous studies showed that Gal4-RXR LBD-VP16 is transcriptionally active while the activity of Gal4-TR LBD-VP16 is repressed (8, 61). This difference in transcriptional activity is consistent with our present finding that N-CoR binds to unliganded TR but not to
RXR. The finding that Sin3A binds to the receptor DBD predicts that the
transcriptional activity of a Gal4-VP16 chimera expressing both the DBD
and LBD of RXR would be repressed compared with a chimera expressing
only the LBD. This prediction was confirmed by comparing the
transcriptional activities of Gal4-RXR(1-450)-VP16 and Gal4-RXR
LBD(206-450)-VP16 (Fig. 15). Gal4-RXR
LBD(206-450)-VP16 was as active as Gal4-VP16, while the activity of
Gal4-RXR(1-450)-VP16 was markedly repressed.

View larger version (29K):
[in this window]
[in a new window]
|
FIG. 15.
Repression of Gal4-RXR(1-450)-VP16 is reversed by the
C-terminal region of PSF-A (cPSF-A). Gal4-RXR(1-450)-VP16 or Gal4-RXR
LBD(206-450)-VP16 was transfected along with a CAT reporter plasmid
(pMC110) in HeLa cells. Gal4-RXR LBD(206-450)-VP16 was as active as
Gal4-VP16, while the activity of Gal4-RXR(1-450)-VP16 was markedly
repressed. cPSF-A (5 and 10 µg) reversed the repression of
Gal4-RXR(1-450)-VP16, resulting in an activity similar to that of
Gal4-RXR LBD(206-450)-VP16. The cPSF-A expression vector (CMX) had no
effect on Gal4-RXR(1-450)-VP16. cPSF-A did not reverse the repression
of Gal4-TR(1-392)-VP16, which, unlike RXR, also binds N-CoR/SMRT
corepressors in the LBD.
|
|
If this repression is mediated through PSF-A, expression of cPSF-A,
which interacts with receptors but lacks the PSF-A repressor domain,
would be expected to block the binding of endogenous PSF-A and thus
relieve the repression of Gal4-RXR(1-450)-VP16. Figure 15 shows that
the expression of cPSF-A results in a marked increase in the
transcriptional activity of Gal4-RXR(1-450)-VP16 which is comparable
to the activities of Gal4-VP16 or Gal4-RXR LBD(206-450)-VP16. Cotransfection of Gal4-RXR(1-450)-VP16 with the control vector (CMX)
used to express cPSF-A had no effect on the activity of Gal4-RXR(1-450)-VP16. A comparison of the effect of the cPSF-A and
control CMX vectors indicated that cPSF-A did not further enhance the
activities of Gal4-VP16 or Gal4-RXR LBD(206-450)-VP16 (not
illustrated). We also studied the effect of cPSF-A on the activity of
Gal4-TR(1-392)-VP16. In contrast with Gal4-RXR(1-450)-VP16, expression of cPSF-A did not lead to reversal of repression of Gal4-TR(1-392)-VP16. This is consistent with our finding that N-CoR/SMRT interacts with the LBD of TR but not RXR and thus maintains Gal4-TR(1-392)-VP16 in a repressed state.
 |
DISCUSSION |
Regulation of gene expression by certain members of the type II
receptor subfamily is thought to result from both the ligand-mediated release of a corepressor(s) and the recruitment of a coactivator(s) to
the LBD. In this study we used a biochemical approach to identify novel
factors that might play a role in receptor function. We purified and
sequenced two proteins which associate with the DBDs of TR and RXR and
identified them as PSF-A (p100) and NonO/p54nrb
(p55). In vitro binding studies indicate that PSF-A interacts directly
with the receptor DBDs whereas NonO/p54nrb
appears to associate with the DBDs as a result of its interaction with
PSF-A. Although both PSF-A and NonO/p54nrb
contain RRMs, these domains are not involved in their interactions with
TR or RXR. RNA does not appear to play a role in the interaction of
PSF-A and NonO/p54nrb with receptors since RNase
incubation does not interfere with the association. In addition, the
association of these proteins with the DBD can occur even in the
presence of a high-affinity cognate DNA recognition sequence. Although
the binding of PSF-A and NonO/p54nrb requires
the DBD, a segment of the D hinge region just C terminal to the DBD
appears to enhance the interaction. PSF-A and
NonO/p54nrb do not interact with the LBDs of TR
or RXR (domains D, E, and F).
The finding that PSF-A and NonO/p54nrb (and TLS)
form a complex with the DBDs of nuclear hormone receptors suggests a
multifunctional role for the DBD in nuclear receptor actions. Indeed,
the DBD of TR has been shown to functionally interact in vivo with p53 (62, 87), which blocks TR binding to DNA, and with human
immunodeficiency virus type 1 tat (18, 19),
which does not block TR binding to DNA. In addition, the
transcriptional activator p/CAF (5) has been reported to
associate with the DBD of RAR or RXR. Thus, in addition to its role in
DNA binding, the DBD of nuclear receptors appears to play an important
role in receptor protein-protein interactions.
PSF was initially cloned as a component thought to be involved in
splicing (58) and NonO as a DNA-binding protein
(85), each with tandem RRMs which exhibit about 70%
identity (21). Although tandem RRMs are thought to be
involved in RNA binding, they may also specifically recognize both
single-stranded and double-stranded DNA sequences (1, 16, 17,
55). NonO/p54nrb and PSF exist both as
free forms and as part of a higher-molecular-weight complex(es), while
TLS does not appear to interact with PSF or NonO/p54nrb (Fig. 3) (91). Although
PSF is thought to play a role in RNA splicing (27, 48, 50, 58,
76), we found that PSF-A acts as a transcriptional repressor,
possibly through the recruitment of HDACs. This conclusion is supported
by the finding that Gal4-PSF-A exhibited repressor activity and that
repression could be reversed by sodium butyrate, an inhibitor of HDACs.
The level of expression of PSF in various tissues, and its possible
regulation by physiologic events, has not been well defined. However,
evidence that the level of PSF may be dynamically regulated comes from
studies in certain tissues indicating that the expression of PSF is
cell type specific and developmentally regulated. For example, PSF mRNA
and protein are highly expressed in differentiating neurons of the
embryonic and neonatal cortex and cerebellum, while their expression
virtually disappears in adult brain tissue (10). This
implies that PSF is not absolutely essential for splicing and also
suggests that PSF may influence the neural differentiation process.
Although PSF was first identified as a putative splicing factor in
association with PTB (58), antibodies against PSF do not
immunoprecipitate PTB, suggesting that not all PSF is associated with
PTB in the cell (53). This finding is also supported by confocal microscopy studies indicating that the majority of PSF and PTB
are not associated in the nucleus (53). Although a body of
evidence from different laboratories support a role for PSF in splicing
(27, 48, 50, 58, 76), the above results support our
findings that PSF may also mediate effects on gene expression
independent of its role as a PTB-associated splicing factor. This
conclusion is also supported by studies indicating that (i) PSF can
influence the activity of topoisomerase I (71, 72) and
(ii) PSF may inhibit expression of the gene encoding the porcine p450
cholesterol side chain cleavage enzyme by binding to a DNA sequence
(CTGAGTC) which is 5' to the Sp1 binding site of the gene
promoter (78).
Several lines of evidence indicate that the repressor activity of PSF-A
is mediated through Sin3A and involves the receptor DBD. First, PSF-A
was found to bind to Sin3A in vitro. Second, immunoprecipitation of
nuclear extracts with antibody to Sin3A also immunoprecipitates PSF.
Third, in vitro binding studies of nuclear extracts with various
regions of GST-RXR indicated that Sin3A and PSF-A interact similarly
with various RXR constructs which contain the DBD but not with
constructs which contain only the RXR LBD (amino acids 206 to 467). In
general, similar results were found for the various domains of TR
[i.e., as with PSF-A, Sin3A binds less efficiently to GST-TR(120-408)
containing the LBD than GST-TR(1-408) (full length) or GST-TR(1-151)
containing the DBD (amino acids 51 to 119)]. Fourth, expression of
cPSF-A, which would be expected to block the binding of endogenous
PSF-A to the DBD of RXR, increases the activity of the repressed
Gal4-RXR(1-450)-VP16 chimera to a level similar to that found for
Gal4-VP16.
The markedly reduced binding of Sin3A to the LBD compared with
full-length receptor or the receptor DBD raised the possibility that
the binding of Sin3A with receptors may not be affected by ligand in
vivo. Indeed, we found that PSF-A and Sin3A bind to full-length TR or
RXR in vivo but that ligand does not dissociate PSF-A or Sin3A from the
receptors. Interestingly, N-CoR bound to TR but not to RXR, which is
consistent with the finding that Gal4-RXR LBD-VP16 is transcriptionally
active while Gal4-TR LBD-VP16 is silent (8, 61).
Surprisingly, although T3 mediated a complete dissociation of N-CoR,
very little if any reduction of Sin3A binding occurred, suggesting that
Sin3A does not associate with LBD bound N-CoR/SMRT in vivo. This
finding is consistent with a recent report indicating that N-CoR/SMRT
may mediate repression independent of Sin3 through a direct interaction
with class II HDACs (36, 40).
The finding that the corepressors N-CoR/SMRT do not bind or only weakly
associate with the LBD of RXR compared with TR suggests that PSF-A may
play a more important role in mediating repression by unliganded RXRs.
Similarly, N-CoR/SMRT has been reported to only weakly associate with
VDR (38, 73) and possibly the PPARs (29).
Thus, PSF-A may also play a role in mediating effects of those
unliganded receptors and possibly a number of orphan receptors as well.
The activation of gene expression by ligand is thought to reflect a
shift in the equilibrium of receptor from an inactive or repressed to
an active state (68). Thus, the extent of transcriptional
activation is dependent, in part, on the absolute and/or relative
levels of repressor(s) and activator(s) that interact with the receptor
in the absence or presence of ligand. Although activation by ligand
through the recruitment of coactivators appears sufficient to overcome
the extent of PSF-A-mediated repression through Sin3A, the DBD-bound
PSF-A-Sin3A may act to fine-tune the transcriptional response. The
extent of this effect would be dependent, in part, on the level and/or
distribution of PSF-A in the cell and whether this level or its
interaction with the receptor DBD is modulated by developmental or
physiologic events.
The observation that PSF acts as a repressor may also explain the
mechanism underlying the development of some papillary renal cell
carcinomas involving the translocation of PSF t(X;1) or inversion of
NonO/p54nrb inv(X) with the TFE3 gene
(13). In each case, the rearrangement results in the
fusion of almost the entire PSF or NonO/p54nrb
protein with the DBD of TFE3, a member of basic helix-loop-helix family
of transcription factors. These chimeras are reminiscent of PML-human
RAR
and PLZF-human RAR
(15, 28, 34, 47) and AML1-ETO
(26, 49), which mediate a differentiation block leading to
leukemia. This block is thought to result from the recruitment of a
repressor (e.g., N-CoR/SMRT) to a gene recognized by the DBD of the
fusion protein. Whether PSF-TFE3 leads to the development of renal cell
carcinoma through repression of a TFE3-regulated gene is unknown but is
a possibility raised by our findings. The finding that PSF and
NonO/p54nrb can interact to form a complex
(91) suggests that p54nrb-TFE3
might also act as a repressor through the recruitment of PSF to the
DNA-bound chimera.
Although our study has focused on the role of PSF-A on influencing the
activity of nuclear hormone receptors via its association with the
receptor DBD, other effects of PSF may be mediated by either PSF-A
and/or PSF-F. Furthermore, PSF-F would be expected to also function as
a repressor, and its unique C terminus may target it to other
transcription factors. Thus, in addition to its possible role as a
splicing factor, PSF may mediate repression (i) through its association
with nuclear hormone receptors, (ii) through its association with other
transcription factors, or (iii) by direct binding to specific genes.
The finding that PSF can interact with multiple factors (e.g., nuclear
hormone receptors, Sin3A, NonO/p54nrb, and
topoisomerase I) and bind to specific DNA sequences suggests that PSF
is a multifunctional protein that mediates diverse activities in the
cell. Our studies establish that PSF can mediate repression through the
Sin3 pathway and define a new mechanism for silencing of gene
expression by nuclear hormone receptors and possibly other transcription factors.
Plasmid containing NonO cDNA and antibodies to NonO and PSF as
well as pET-PSF1 were from the P.W.T. laboratory and have not been
previously described. We also thank James Patton for antibodies to PSF,
Mitchell Lazar for antibodies to N-CoR, and Martin Privalsky for the
GST-Sin3 and GST-SMRT clones. We also thank Dansheng Li, Muktar
Mahajan, and Bruce Raaka of the H.H.S. laboratory for critically reading the manuscript.
This research was supported by NIH grants DK16636 (H.H.S.), AI18016
(P.W.T.), and AR02083 (M.M.). H.H.S is a member of the NYUMC Cancer
Center (CA16087). Sequence analysis and database searches were through
the NYUMC Research Computing Resource, which received support from the
National Science Foundation (DIR-8908095).