Glaxo-IMCB Group, Institute of Molecular & Cell Biology, Singapore 117609, Singapore,1 and
Institute of Neurology, University College London, London WC1N
1PJ, United Kingdom2
Received 5 October 2000/Returned for modification 3 November
2000/Accepted 31 January 2001
Myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) is a
Cdc42-binding serine/threonine kinase with multiple functional domains.
We had previously shown MRCK
to be implicated in Cdc42-mediated peripheral actin formation and neurite outgrowth in HeLa and PC12 cells, respectively. Here we demonstrate that native MRCK exists in
high-molecular-weight complexes. We further show that the three independent coiled-coil (CC) domains and the N-terminal region preceding the kinase domain are responsible for intermolecular interactions leading to MRCK
multimerization. N terminus-mediated dimerization and consequent transautophosphorylation are critical processes regulating MRCK
catalytic activities. A region containing the two distal CC domains (CC2 and CC3; residues 658 to 930) was found
to interact intramolecularly with the kinase domain and negatively
regulates its activity. Its deletion also resulted in an active kinase,
confirming a negative autoregulatory role. We provide evidence that the
N terminus-mediated dimerization and activation of MRCK and the
negative autoregulatory kinase-distal CC interaction are two mutually
exclusive events that tightly regulate the catalytic state of the
kinase. Disruption of this interaction by a mutant kinase domain
resulted in increased kinase activity. MRCK kinase activity was also
elevated when cells were treated with phorbol ester, which can interact
directly with a cysteine-rich domain next to the distal CC domain. We
therefore suggest that binding of phorbol ester to MRCK releases its
autoinhibition, allowing N-terminal dimerization and subsequent kinase activation.
 |
INTRODUCTION |
Rho GTPases have been shown to
regulate a wide range of cellular activities, particularly actin
cytoskeleton assembly and organization. Most of the findings described
are from studies on Rho and the related proteins Rac and Cdc42
(17). It is well documented that Rho mediates the
formation of actin-based stress fibers and focal adhesions induced by
lysophosphatidic acid and Rac regulates the formation of
platelet-derived growth factor-induced membrane ruffles, whereas Cdc42
is involved in peripheral filopodium formation induced by bradykinin.
Many of the downstream activities of these GTPases are mediated through
tight regulation of their specific effectors in response to
extracellular stimuli (7, 28).
There is evidence that Rho regulates the assembly of stress fibers and
focal adhesions through the cooperation of Rho kinase (ROK) and
Diaphanous (35, 45). Some other effectors of Rho include
protein kinase N, rhotekin, rhophilin, citron, and citron kinase (see
reference 7 for a review). Partner of Racl and WASP family
verprolin-homologous protein have been implicated in Rac-induced
membrane ruffling (33, 43), whereas
phosphatidylinositol-4-phosphate-5-kinase has been shown to be involved
in Rac-dependent actin filament assembly (41). Cdc42
has been demonstrated to regulate actin cytoskeletal changes through
various specific downstream effectors, such as Wiskott-Aldrich
syndrome protein and N-Wiskott-Aldrich syndrome protein, in actin
polymerization and filopodium formation (6), p21-activated
kinase (PAK) in regulation of actomyosin and focal adhesion assembly
(31, 39, 48), and IQGAP in regulation of cell-cell
junction adhesion (23).
Myotonic dystrophy kinase-related Cdc42-binding kinase (MRCK) is
another effector of Cdc42 isolated based on their specific interaction
(27). Its expression is ubiquitous but is highest in the
brain. We previously reported that MRCK potentially acts downstream of
Cdc42 in actin cytoskeletal reorganization, particularly Cdc42-mediated
peripheral actin formation. In Drosophila, mutations of the
gek (a Drosophila homolog of MRCK) locus
exhibited abnormal F-actin accumulation and a defect in fertilized-egg
production, a phenotype downstream of Drosophila Cdc42
(29). A possible involvement of MRCK
in the regulation
of neurite outgrowth in PC12 cells has also been proposed
(10), consistent with the view that Cdc42, rac-1, and
their effectors are involved in the differentiation of neuronal cells
(14, 22).
MRCK
and -
are the two known isoforms of the multidomained
serine/threonine protein kinases. ROKs (19, 26, 32) and myotonic dystrophy protein kinase (DMPK) (4, 13) are two other protein kinases closely related to MRCKs. These kinases share
homology in their N-terminal kinase domains and, to a certain extent,
with other domain arrangements. Interestingly, they all contain a
highly conserved stretch of about 70 amino acids N terminal to the
kinase domain (termed the leucine-rich domain in DMPK) that is
immediately followed by an extended coiled-coil (CC) domain. DMPK is
smaller than ROK and MRCK and lacks the various regulatory modules
present in the C-terminal halves, except for a membrane association
domain (44). Besides the formation of stress fibers and
focal adhesions, ROK has also been implicated in other Rho-mediated cellular functions, such as the regulation of intermediate filament assembly (15, 40), neurite remodeling (2, 10,
18), cytokinesis (15, 21), transcription
regulation, and cell transformation (11, 38). DMPK is
implicated in myotonic dystrophy, an age-related neuromuscular disorder
characterized by increasing CTG repeats at the 3' end of the noncoding
sequence. Its expression is most abundant in skeletal and cardiac
muscles, where it has been localized to the neuromuscular junction and
the intercalated disk (30). The in vivo function and
regulation of DMPK are still unclear, but it is predicted to
participate in as yet unidentified signal transduction pathways.
It is important to understand how the specific effectors of the GTPases
are regulated in order to elucidate the complexity and coordination of
the downstream cellular events. In the current work, we analyzed the
regulation of MRCK
with regard to its autoregulation and activation.
We demonstrate here that native MRCK exists as multimeric complexes. In
the inactive state, the kinase is usually kept in a closed
conformation, held by the stable interaction between the kinase domain
and the negative autoregulatory domain encompassed within the distal CC
domain. We also show that the subsequent catalytic activity is
dependent on the N terminus-mediated dimerization-transautophosphorylation events. Disruption of the interaction of the distal CC domain and the catalytic domain and treatment of cells with phorbol ester both led to increases in MRCK
kinase activities, suggesting that these effects interfere with the
formation of a native kinase-autoinhibitory complex, thus allowing
dimerization and subsequent kinase activation.
 |
MATERIALS AND METHODS |
Construction of MRCK
cDNA constructs.
Full-length MRCK
and MRCK
-CAT1-473 in mammalian expression vector pXJ40
containing an N-terminal FLAG or hemagglutinin (HA) tag were
constructed as previously described (31). Kinase-dead
MRCK
-KDK106A,1-473 was obtained by replacing the
N-terminal BamHI/BstXI fragment of
MRCK
-CAT1-473 with that of MRCK
-KDK106A
previously cloned (27). The N terminus deletion mutant
forms MRCK
-
N-CAT70-473 and
MRCK
-
N-KDK106A,70-473 were obtained from
BamHI/PstI-digested PCR products of
MRCK
-CAT1-473 and MRCK
-KDK106A,1-473
constructs, respectively, with primer
5'-CTGGATCCATGCGCTTACATAGAGAAG-3' and reverse primer pXJ40.
A two-step PCR protocol was used for mutagenesis (27)
using VENT polymerase (New England Biolabs) to generate the following
point mutations. MRCK
-CATS222L,1-473 was obtained
with primer 5'-TGCTAAACGAATATGTC-3'-T7 and a
5'-GATTTTGGTCTTTGTCTGAAG-3'-pXJ40 reverse primer,
MRCK
-CATT231A,1-473 was obtained with primer
5'-CCATCTTCCATCAGCTTC-3'-T7 and a
5'-CGCCGTCCAGTCCTCAGTGGCAG-3'-pXJ40 reverse primer,
MRCK
-CATS234A,1-473 was obtained with
primer 5'-CCACTGAAGCCTGGACCGTTCCATCTTC-3'-T7 and a
5'-CAGTTGGAACTCCAGACTAC-3'-pXJ40 reverse primer,
MRCK
-CATS235A,1-473 was obtained with primer
5'-CCATCTTCCATCA GCTCC-3'-T7 and a
5'-AACGGTCCAGTCGGCCGTGGCAGTTGGAACTC-3'-pXJ40 reverse
primer, MRCK
-CATT240A,1-473 was obtained with primer
5'-TTCCGGGGAAATGTAGTCTGGAGCTCCAACTGC-3'-T7 and a
5'-ATCCTTCAGGCTATGGAGGAC-3'-pXJ40 reverse primer,
MRCK
-CATS245A,1-473 was obtained with primer
5'-TTCCGGGGCAATGTAGTCTGG-3'-T7 and a 5'-ATCCTTCAGGCTATGGAGGAC-3'-pXJ reverse primer, and
MRCK
-CATT403A,1-473 was obtained with primer
5'-GCTACTAGTATATGCAAACCCAACAAATG-3'-T7 and a
5'-TGTGTTCTTTCTGATCGGAGC-3'-pXJ40 reverse primer, with
pXJ40-FLAG-MRCK
-CAT1-473 used as the template. All
mutations were checked by DNA sequencing. A 3.3-kb BamHI
fragment of full-length pXJ40-FLAG-MRCK
was ligated to the
BamHI-cut pXJ40-FLAG vector to generate the
MRCK
1-1091 construct. To obtain
pXJ40-FLAG-MRCK
1-710, a 2.1-kb
BamHI/EcoRI fragment of full-length
pXJ40-FLAG-MRCK
was first ligated to pGEX4T1 and subsequently
subcloned into the pXJ40-FLAG vector by
BamHI/XhoI digestion. The CC domain pXJ40-FLAG- and HA-MRCK
-CC466-1018 constructs were derived from a
2.9-kb HincII/XmnI partial-digestion fragment of
full-length cDNA. It was first ligated in frame to SmaI-cut
pGEX4T1 and next subcloned into pXJ40 vectors by
BamHI/XhoI digestion. Like
MRCK
-CC466-1018, the MRCK
-CC1466-710,
MRCK
-CC2710-854 and
MRCK
-CC2/3658-930 constructs were all first subcloned
in frame in suitable pGEX vectors and later moved into pXJ40 vectors
with BamHI/XhoI digestion: MRCK
-CC1466-710 was subcloned from a 732-bp partial
HincII/XhoI fragment of
MRCK
1-710, MRCK
-CC2710-854 was obtained
from a 433-bp EcoRI fragment of full-length cDNA, and
MRCK
-CC2/3658-930 was obtained from an 816-bp
PvuII fragment of the full-length cDNA. The CC deletion
mutant form MRCK
-
CC2
750-875 was obtained by
replacing the wild-type construct with a
PstI/NheI-digested PCR product with primers
5'-TTCCCTTCTGGTTTTTTCC-3'-T7 and
5'-GACATGTCAGCTAGACTAG-3'-5'-GTCTCGCTGTCGGCTAG-3', and
MRCK
-
CC2/3
750-938 was obtained with primers
5'-TTCCCTTCTGGTTTTTTCC-3'-T7 and
5'-AGATCTGAAAAGGTGTAG-3'-5'-GTCTCGCTGTCGGCTAG-3'. A 341-bp
PvuII/EcoRV fragment of full-length MRCK
was
ligated to the SmaI-cut pGEX-1 vector to generate an
MRCK
-CRD construct. A summary of all of the constructs used in this
study is shown in Fig. 1.

View larger version (17K):
[in this window]
[in a new window]
|
FIG. 1.
Schematic diagram of the various MRCK constructs used in
this study. The conserved N terminus (N), kinase domain (Kinase), CC1,
-2, and -3, CRD, pleckstrin homology domain (PH), citron homology
domain (CH), and PBD are shown. aa, amino acids.
|
|
Gel filtration chromatography.
A Sepharose CL-6B-200
(Pharmacia) column of 1.8 × 45 cm was equilibrated with lysis
buffer (25 mM HEPES [pH 7.7], 0.2 M NaCl, 1.5 mM MgCl2,
0.2 mM EDTA, 20 mM
-glycerolphosphate, 1 mM sodium orthovanadate,
0.05% Triton X-100, 5% glycerol) and calibrated with the standard
molecular mass markers thyroglobulin (669 kDa), apoferritin (443 kDa),
alchohol dehydrogenase (150 kDa), and albumin (66 kDa). Crude rat brain
extract prepared in lysis buffer using a Dounce homogenizer was
clarified by centrifugation at 100,000 × g for 30 min
at 4°C. The soluble supernatant was applied to the CL-6B-200 column
at a flow rate of 0.12 ml/min. Fractions of 0.25 ml were collected and
subjected to sodium dodecyl sulfate (SDS)-polyacrylamide gel
electrophoresis (PAGE) analysis. Positions of MRCK and p125FAK were
determined by Western blot analysis with respective antibodies.
BS3 cross-linking assay.
COS-7 cells with and
without overexpresson of various MRCK
proteins were extracted in
lysis buffer. Protein concentrations of the soluble extracts were
adjusted to 1 to 3 mg/ml. Cross-linking reactions began with addition
of 0.05 to 0.5 mM bis(sulfosuccinimidyl)suberate (BS3;
Pierce) at 4°C for 30 min. Reactions were stopped by addition of an
equal volume of SDS-PAGE sample buffer. Cross-linked products were
detected by immunoblotting with either anti-MRCK antibody (27) or anti-FLAG antibody (Sigma) for detection of the
endogenous MRCK and overexpressed FLAG-tagged MRCK proteins, respectively.
Phorbol ester binding assay.
Phorbol ester binding was
measured using [20(n)-3H]phorbol-12,13-dibutyrate (PDBu;
Amersham). Glutathione S-transferase (GST)-MRCK
-CRD (10 µg) was incubated with 60 nM PDBu (19 Ci/mmol; Amersham Pharmacia) in
buffer containing 25 mM Tris (pH 7.5), bovine serum albumin (4 mg/ml),
and 2 mM CaCl2, with or without phosphatidylserine at 100 µg/ml, for 30 min at room temperature and then placed on ice for
another 30 min. Samples were filtered on prewetted GF/C filter discs
(Whatman) and then washed with 5 ml of ice-cold 25 mM Tris (pH 7.5).
Filters were dried, and binding activity was quantified using an LKB
scintillation counter.
Transfection and immunofluorescence assay.
HeLa and COS-7
cells were cultured in medium containing 10% fetal bovine serum and
transfected with various FLAG- and HA-tagged DNA constructs (1 µg/ml)
using Lipofectamine (6 µl/ml; GIBCO/BRL) as previously described
(26, 31). For immunofluorescence studies, HeLa cells were
plated on glass coverslips, transfected, and fixed with 4%
paraformaldehyde after 16 h of incubation. An anti-FLAG monoclonal
antibody (5 µg/ml; Sigma) and a fluorescein isothiocyanate-conjugated secondary antibody (1:100; Boehringer Mannheim) were used to stain transfected cells. Rhodamine-conjugated phalloidin (1 µg/ml; Sigma) was used to visualize the actin filaments. Stained cells were analyzed
with a Hamamatsu C4742-98 digital camera adapted to a Leica
fluorescence microscope. Metamorph Imaging software (Universal Imaging
Corp.) was used to capture and store images.
Immunoprecipitation and kinase assay.
For
immunoprecipitation experiments, cells grown in a 100-mm-diameter dish
were transfected and incubated for 16 h before being harvested in
lysis buffer. Clarified cell extracts were incubated with
anti-FLAG-conjugated agarose beads (Sigma) for 1 to 2 h at 4°C.
After extensive washing, the immunoprecipitates were either subjected
to kinase assays or boiled for 5 min in SDS-sample buffer and resolved
by SDS-PAGE for Western blot analysis. Immunoprecipitation of
endogenous MRCK was carried out in a similar way, except that MRCK
antibody and protein A-conjugated Sepharose beads (Sigma) were used.
Kinase assays were carried out at 30°C for 10 min using GST-MLC2 as
the substrate (27) in buffer containing 10 µM
[
-33P]ATP (2,500 Ci/mmol; NEN), 25 mM HEPES (pH 7.3),
25 mM KCl, 5 mM
-glycerolphosphate, 2.5 mM sodium fluoride, 5 mM
MgCl2, 1 mM MnCl2, and 0.025% Triton X-100.
Autophosphorylation assays were carried out as described above, except
that no exogenous substrate was added.
PMA treatment.
Subconfluent HeLa cells with or without serum
starvation were treated with phorbol 12-myristate 13-acetate (PMA;
Sigma) at 300 ng/ml for 30 min before being harvested in lysis buffer
for immunoprecipitation using anti-MRCK antibody for activity
measurement. For treatment in a cell-free assay, serum-starved HeLa
cells from two 100-mm-diameter dishes were harvested with 50 µl of
lysis buffer containing 25 mM HEPES (pH 7.7), 0.15 M NaCl, 5 mM
MgCl2, 20 mM
-glycerolphosphate, 1 mM sodium
orthovanadate, and 0.05% Triton X-100. Clarified cell extracts were
incubated with 0.5 µM PMA in the presence of 2 mM ATP and 2 µg of
phosphatidylserine at 30°C for 20 min. The volume of the cell
extracts was then adjusted to 0.5 ml with the same lysis buffer before
immunoprecipitation for activity measurement as previously described.
 |
RESULTS |
Native MRCK exists in high-molecular-weight complexes.
The CC domain of MRCK
(residues 425 to 938) constitutes almost a
third of the full-length protein, and it shares some homology with the
nonmuscle myosin heavy chain C-terminal CC region. As the myosin heavy
chain CC tail has been demonstrated to entwine to form an extended
parallel CC for self-assembly (5), we examined the
quaternary complexity of native MRCK. Rat brain soluble extract was
applied to a CL-6B gel filtration column calibrated with standard molecular mass markers. The position of MRCK in the elution profile was
determined by immunoblot analysis with anti-MRCK
antibody. As shown
in Fig. 2A, MRCK was largely eluted as
two continuous peaks, a major peak of approximately 900 kDa and a
smaller, trailing peak of about 500 kDa. No MRCK
migrated in the
190-kDa range, while p125FAK was eluted mostly at 130 kDa under the
same experimental conditions (data not shown).

View larger version (26K):
[in this window]
[in a new window]
|
FIG. 2.
Gel filtration chromatography and chemical cross-linking
reveal the multimeric nature of MRCK. (A) Rat brain extract was applied
onto a Sepharose CL-6B-200 gel filtration column. Fractions were
collected, and the relative amount of MRCK in each fraction was
determined by Western blotting with anti-MRCK antibody (inset) using a
Bio-Rad laser densitometer. The elution profile of the standard
molecular mass markers used is indicated by arrowheads. (B) COS-7 cell
extracts from untransfected cells or cells expressing plasmid-encoding
FLAG-MRCK were exposed to increasing concentrations of the
cross-linking agent BS3 as indicated. Cross-linked
endogenous MRCK and overexpressed FLAG-MRCK were determined by
Western blotting (WB) with anti-MRCK or anti-FLAG antibody. The arrow
indicates the slow-migrating cross-linked products.
|
|
We verified this observation using chemical cross-linking. COS-7 cell
extracts prepared from untransfected cells and cells overexpressing
FLAG-MRCK
were incubated with increasing concentrations of the
cross-linking agent BS3. The presence of multimeric
complexes was characterized by the detection of a single
slow-migrating band (Fig. 2B). Both endogenous MRCK and overexpressed
MRCK
were cross-linked by BS3 in a
concentration-dependent manner. The results of gel filtration and
chemical cross-linking experiments suggest that native MRCKs exist in a
multimeric state.
A putative CC domain and N terminus region facilitate MRCK
multimerization.
The MRCK
predicted CC domain consists of three
discrete blocks with characteristic heptad repeats (Fig. 1; also refer
to reference 29). We designated these CC1 (residues 425 to
669), CC2 (a putative leucine zipper, residues 750 to 809), and CC3 (residues 875 to 938). To determine whether these CC domains of MRCK
are responsible for multimerization, we investigated the ability of the
whole of the central CC domain to self-associate by
coimmunoprecipitation. Extracts of COS-7 cells doubly transfected with
the HA- or FLAG-tagged CC domain (HA- or
FLAG-MRCK
-CC466-1018) were immunoprecipitated using
anti-FLAG antibody. Our results show that
HA-MRCK
-CC466-1018 readily associated with
FLAG-MRCK
-CC466-1018, as it was coimmunoprecipitated
(Fig. 3A). Reverse immunoprecipitation using anti-HA antibody gave similar results (Fig. 3B). Furthermore, addition of BS3 to the cell extract containing
overexpressed FLAG-MRCK
-CC466-1018 resulted in the
appearance of multimeric cross-linked products (Fig. 3C). We also
tested the ability of the smaller individual CC1 and CC2 domains to
self-interact. As shown in Fig. 3D, HA-MRCK
-CC1466-710
and HA-MRCK
-CC2710-854 were readily detected in the
immunoprecipitates of FLAG-MRCK
-CC1466-710 and
FLAG-MRCK
-CC2710-854, respectively. The combined
MRCK
-CC2/3 region was also able to self-interact. These homotrophic
interactions between the respective individual CC regions were
specific, and no heterotrophic interaction between the CC1 and CC2
regions was observed (data not shown). Thus, the CC domains of MRCK
probably entwine to form parallel structures that drive MRCK
oligomerization.

View larger version (52K):
[in this window]
[in a new window]
|
FIG. 3.
MRCK CC domains are essential for self-interaction.
(A) The HA-tagged MRCK -CC466-1018 construct was
expressed alone (lane 1) or coexpressed with FLAG-tagged
MRCK -CC466-1018 in COS-7 cells (lane 2).
Immunoprecipitations (IP) were carried out using anti-FLAG antibody,
and the immunoprecipitates recovered were probed with anti-HA or
anti-FLAG antibodies. (B) The FLAG-tagged
MRCK -CC466-1018 construct was expressed alone (lane 1)
or coexpressed with HA-tagged MRCK -CC466-1018 in COS-7
cells (lane 2). IP was carried out using anti-HA antibody, and the
immunoprecipitates recovered were probed with anti-HA or anti-FLAG
antibodies. (C) Extracts from COS-7 cells expressing plasmid-encoded
FLAG-MRCK -CC466-1018 were exposed to increasing
concentrations of BS3 as indicated. Cross-linked products
were detected by Western blotting (WB) with anti-FLAG antibody. The
arrows indicate the slow-migrating cross-linked products. (D) HA- and
FLAG-tagged constructs of CC1 (MRCK -CC1466-710; lane
1), CC2/3 (MRCK -CC2/3658-930; lane 2), and CC2
(MRCK -CC2710-854; lane 3) covering different portions
of the CC domain were cotransfected into COS-7 cells and subjected to
IP with anti-FLAG antibody. The immunoprecipitates recovered were
immunoblotted with anti-HA or anti-FLAG antibodies.
|
|
In addition, we also found that the first 70 amino acids of MRCK
could mediate dimerization of the kinase domain. As shown in Fig.
4A, HA-MRCK
-CAT1-473 was
readily coimmunoprecipitated with FLAG-MRCK
-CAT1-473
but not with the N terminus deletion mutant construct
FLAG-MRCK
-
N-CAT70-473. Again in a BS3
cross-linking assay, FLAG-MRCK
-CAT1-473 was readily
cross-linked in a concentration-dependent manner (Fig. 4B). By
contrast, no cross-linked product was detected with FLAG-MRCK
-
N-CAT70-473. In the Western blot, the only
major cross-linked product of FLAG-MRCK
-CAT1-473
exhibited a size consistent with the formation of a dimer. This N-terminal sequence stretch preceding the kinase domain is highly conserved among MRCK isoforms and the two closely related kinases ROK
and DMPK. It is also noticeably conserved with the C-terminal sequence
of a functionally unrelated plant DNA-binding protein, GT1a (Fig. 4C;
also refer to reference 24). This motif in GT1a has been
shown to be responsible for its oligomerization. Our results provide
direct evidence that both the CC domain and the conserved N terminus
could play a part in maintaining the quaternary structure of MRCK
through intermolecular interactions.

View larger version (31K):
[in this window]
[in a new window]
|
FIG. 4.
The conserved N-terminal sequence mediates kinase domain
dimerization. (A) The FLAG-tagged catalytic domain
(MRCK -CAT1-473; lanes 1 and 3) or N-CAT
(MRCK - N-CAT70-473; lanes 2 and 4) construct was
coexpressed with HA-tagged CAT. Immunoprecipitations were carried out
using anti-FLAG antibody, and the immunoprecipitates recovered were
blotted with anti-HA or anti-FLAG antibody. (B) Extracts from cells
expressing the plasmid encoding FLAG-tagged CAT or N-CAT were
exposed to increasing concentrations of BS3 as indicated.
The arrow indicates the 100-kDa cross-linked products. (C) Sequence
alignment of the N-terminal sequences of MRCK and - , ROK , and
DMPK1 and the C-terminal sequence of GT1a was performed with the
Clustal method (DNASTAR). Conserved residues are boxed in black, and
numbers indicate the positions of residues.
|
|
N terminus-mediated dimerization and
transautophosphorylation are essential for MRCK
catalytic
activity.
We next investigated the relationship between N
terminus-dependent kinase domain dimerization and kinase activity. As
shown in Fig. 5A, deletion of 70 residues
from the conserved MRCK
N terminus resulted in essentially complete
loss of the kinase activity of FLAG-MRCK
-CAT1-473
toward myosin light chain (MLC2). Similar results were obtained by
comparing full-length MRCK
with
70N-MRCK
(data not shown). This demonstrated that the N-terminal nonkinase sequence is essential for catalytic activity. A conceivable requirement for dimerization would be intermolecular transautophosphorylation to allow kinase activation (37, 47). To test this, we isolated
heterodimers consisting of wild-type HA-MRCK
-CAT1-473
and a kinase-dead kinase domain and tested their activity toward MLC2.
If transautophosphorylation is required for activation, pairing up of
the wild-type kinase domain with an inactive mutant would result in an
inactive dimer (37). Indeed, the heterodimer was as
inactive as the homo-FLAG-MRCK
-KDK106A,1-473 dimer
(Fig. 5B). Furthermore, constitutively active
FLAG-MRCK
-CAT1-473 was unable to phosphorylate the
GST-MRCK
-KDK106A,1-473 fusion protein (data not shown),
implying that the transautophosphorylation event is likely to take
place within the dimer.

View larger version (36K):
[in this window]
[in a new window]
|
FIG. 5.
Dimerization and subsequent transautophosphorylation of
the kinase domain are required for MRCK kinase activity. (A)
FLAG-CAT, FLAG- N-CAT, and FLAG-KD (MRCK-KDK106A,1-473)
were individually overexpressed in COS-7 cells and subjected to
immunoprecipitation (IP) using anti-FLAG antibody. Kinase activities
were assayed using GST-MLC2 as the substrate (left side).
Phosphorylation levels of [33P]GST-MLC2 were quantified
on a PhosphorImager, and the means and standard errors of activities
relative to that of wild-type CAT (100%) from three independent
experiments are shown on the right. (B) COS-7 cells were transfected
with HA-CAT, HA-CAT and FLAG-KD (CAT/KD), or FLAG-KD alone. Expressed
proteins were immunoprecipitated with either anti-HA antibody or
anti-FLAG antibody as indicated. The immunoprecipitated products
recovered were assayed for kinase activity using GST-MLC2 as the
substrate (left side). The phosphorylation levels quantified are shown
as the means and standard errors of activities relative to that of the
wild-type CAT domain (100%) from three independent experiments on the
right. (C) Comparison of the amino acid sequences in the activation
loop and the hydrophobic phosphorylation motif of MRCK and - ,
ROK and - , and DMPK1. Potential phosphorylation sites in MRCK
are highlighted by asterisks, and positions are numbered. Boldface
letters indicate conserved potential phosphorylation residues found in
the related proteins. (D) The overexpressed proteins of all of the
MRCK mutant constructs were immunoprecipitated with anti-FLAG
antibody and subjected to in vitro autophosphorylation assays with
[ -33P]ATP or assayed with GST-MLC2 as the substrate in
panel E. The mutant constructs were transfected into HeLa cells, and
the effects on actin filament arrangements were examined by
rhodamine-conjugated phalloidin staining. A plus sign indicates a
robust actin filament condensation phenotype, and a minus sign
indicates absence of effect (E, bottom). WB, Western blot.
|
|
Phosphorylation of key residues within the activation loop and the
extended hydrophobic phosphorylation motif provide the means for
activation of many protein kinases (9, 34, 36). Autophosphorylation site mapping of recombinant
GST-MRCK
-CAT1-473 revealed that the major
autophorylation sites reside within two neighboring tryptic peptides,
namely, DFGSCLK and LMEDGTVQSSVAVGTPDYISPEILQAMEDGK, that are located within the activation loop of the kinase domain (Fig. 5C). To test the role of specific residues in these peptides, individual serine and threonine residues, together with threonine 403 in the hydrophobic phosphorylation motif, were replaced with alanine
(except for serine 222, which was changed to a leucine residue). Three
mutations, S234A, T240A, and T403A, strongly affected the in vitro
autophosphorylation activity of
FLAG-MRCK
-CAT1-473 (Fig. 5D). We noticed that S222L
consistently exhibited enhanced autophosphorylation activity relative
to the wild type, although its activity toward GST-MLC2 remained
unchanged (Fig. 5E). An equivalent residue in Pim-1 serine/threonine
kinase has been shown to be critical for its activity
(36). The role of this residue in MRCK
is unclear, but
it may be involved in modulation of the catalytic property. The mutants
with defective autophosphorylation also poorly phosphorylated the
GST-MLC2 substrate (Fig. 5D and E). Despite the defects in the
phosphorylation properties of these mutant constructs, kinase
dimerization was not perturbed (data not shown). Consistent with the
biochemical data, overexpression of these three mutant forms in HeLa
cells did not elicit the actin filament contraction-condensation
phenotype (27) shown by the wild-type kinase domain and
another point mutant construct (Fig. 5E and
6B). Taken together, our data suggest
that N terminus-mediated dimerization and transautophosphorylation are
two events important for kinase activity. It is noteworthy that
residues equivalent to S-234, T-240, and T-403 are all present in DMPK,
while ROK shows conservation only of residues equivalent to T-240 and
T-403 (Fig. 5C).


View larger version (88K):
[in this window]
[in a new window]
|
FIG. 6.
C terminus deletion mutations reveal a potential
negative autoregulatory region in MRCK . (A) pXJ40-FLAG-tagged
constructs were transfected into COS-7 cells, and expressed proteins
were immunoprecipitated (IP) with anti-FLAG antibody for kinase assay
using GST-MLC2 as the substrate (left side). The quantified
phosphorylation levels are shown on the right as the means and standard
errors of activities relative to the wild-type (w/t) level (taken as 1)
from three independent experiments. WB, Western blot. (B) Effects of
overexpression of the C terminus deletion mutant constructs on actin
filament rearrangement in HeLa cells. Cells were doubly stained with
anti-FLAG antibody to show transfected cells (left) and phalloidin to
show actin filaments (right). Transfected cells were marked with
asterisks. Scale bar = 10 µm.
|
|
The kinase domain is negatively regulated by an autoregulatory
region within the distal CC domain.
Our previous work showed that
the expression of the MRCK
kinase domain in HeLa cells elicited a
dramatic actin contraction-condensation effect, while expression of the
wild-type construct only resulted in slight enhancement of stress fiber
formation (27). This indirectly reflected the fact that
full-length MRCK
is catalytically less active than the kinase domain
alone. A possible reason for this is the involvement of a negative
autoregulation event. To test this assumption, as well as to locate
such an autoregulatory region, we compared the activities of four
MRCK
constructs of different lengths in the C terminus, namely,
MRCK
, MRCK
1-1091, MRCK
1-710, and the
kinase domain MRCK
-CAT1-473 (Fig. 1). From the in vitro
kinase assays, it is apparent that these four constructs represented
two sets of activity (Fig. 6A): full-length FLAG-MRCK
and
FLAG-MRCK
1-1091 represent the less active group, while
FLAG-MRCK
1-710 and FLAG-MRCK
-CAT1-473
represent the more active species. Overexpression of these constructs in HeLa cells gave similar results (Fig. 6B). Both FLAG-MRCK
and
FLAG-MRCK
1-1091 showed enhanced stress fiber formation,
while cells transfected with FLAG-MRCK
1-710 and the
FLAG-MRCK
-CAT1-473 construct exhibited strong actin
contraction-condensation phenotypes. These results suggest that an
internal region between residues 710 and 1091 is the negative
autoregulatory region responsible for keeping wild-type MRCK
inactive, as its deletion correlates with an acquisition of increases
in kinase activities.
Intriguingly, this putative autoregulatory region encompasses the
CC2-CC3 (CC2/3) domain and the neighboring cysteine-rich domain (CRD)
(Fig. 1). We therefore tested whether the kinase domain could interact
with the CC2/3 region. As shown in Fig. 7A, the MRCK
kinase domain was able to
bind CC2 and a more pronounced interaction was observed with the larger
CC2/3 region. No interaction with CC1 was detectable, by
coimmunoprecipitation assays, ruling out nonspecific interactions. The
conserved N-terminal sequence is not required for such an association,
since its deletion had no effect on the interaction (data not shown).

View larger version (58K):
[in this window]
[in a new window]
|
FIG. 7.
Interaction between the distal CC domains and the kinase
domain causes MRCK kinase inhibition. (A) COS-7 cells were
cotransfected with a pXJ40 vector containing HA-CC2 or HA-CC2/3 (Fig.
3), together with each of the various FLAG-tagged MRCK kinase domain
constructs, as indicated (bottom). Immunoprecipitations (IP) were
carried out with anti-FLAG antibody, and the IP products were Western
blotted (WB) with anti-HA or anti-FLAG antibodies. Expressions of the
HA-tagged CC domains in total extracts are shown at the top, and HA-CC1
was used as the negative control. (B) COS-7 cells were cotransfected
with plasmids encoding FLAG-CC2/3 alone (left lane), HA-CAT alone
(middle lane), and FLAG-CC2/3 together with HA-CAT (right lane). IP
were carried out using either anti-FLAG or anti-HA antibodies as
indicated, and the products were subjected to kinase assays using
GST-MLC2 as the substrate. The immunoprecipitated products recovered
were immunoblotted with anti-HA or anti-FLAG antibodies (Ab). IgG,
immunoglobulin G. (C) COS-7 cells expressing the FLAG-tagged deletion
mutant forms CC2 (MRCK - CC2 750-809 and CC2/3
(MRCK - CC2/3 750-938) were immunoprecipitated with
anti-FLAG antibody and assayed for kinase activities toward GST-MLC2
(left). The GST-MLC2 phosphorylation levels shown are means and
standard errors of activities relative to that of wild-type (W/T)
MRCK (right). (D) Effects of the expression of CC deletion mutant
forms on actin filament rearrangement in HeLa cells. Transfected cells
with the various wild-type and mutant constructs were doubly stained
with anti-FLAG antibody to show transfected cells (left) and with
phalloidin to show actin filaments (right). Transfected cells are
marked with asterisks. Scale bar = 10 µM.
|
|
To establish unequivocally the CC region as the negative autoregulatory
domain, we showed that wild-type kinase domain
HA-MRCK
-CAT1-473 coimmunoprecipitated with
FLAG-MRCK
-CC2/3 and this specific interaction resulted in
inactivation of the catalytic activity toward GST-MLC2 (Fig. 7B).
Further support of this was derived by deletion of the CC2
(FLAG-MRCK
-
CC2
750-875) or CC2/3
(FLAG-MRCK
-
CC2/3
750-938) region from wild-type
MRCK
. Expression of either construct in COS-7 cells resulted in
about threefold higher activity (Fig. 7C). Furthermore, overexpression
of these deletion constructs in HeLa cells generally produced moderate
increases in actin stress fibers (Fig. 7D). This effect is different
from those observed with truncated mutant forms which lack the
C-terminal regulatory domains. It is possible that the presence of the
functional modules (CRD, pleckstrin homology domain, and p21-binding
domain [PBD]) in the intact C terminus determines its intracellular
distributions and subsequent specific functions. Taken together, our
findings show that the CC2/3 region can negatively regulate MRCK
kinase activity and that the intramolecular interaction of the distal CC2/3 region with the kinase domain forms the basis of this inhibition.
N terminus-mediated kinase dimerization and the kinase-distal CC
interaction are mutually exclusive processes regulating the catalytic
state of MRCK
.
We then examined how the two opposite events,
namely, N terminus-dependent dimerization and CC-mediated inhibition,
may coordinately regulate MRCK
activity. It was noticed that the
interaction between active FLAG-MRCK
-CAT1-473 and
HA-MRCK
-CC2 (Fig. 7A, lane 2) was somewhat weaker than that with kinase-inactive proteins such as
FLAG-MRCK
-KDK106A,1-473,
FLAG-MRCK
-
N-CAT70-473, and
FLAG-MRCK
-
N-KDK106A,70-473. This prompted us
to investigate whether the active and inactive kinase domains have
differential affinity toward the CC region. To determine this, both
FLAG-MRCK
-CAT1-473 and
FLAG-MRCK
-KDK106A,1-473 were separately coexpressed
with increasing levels of HA-MRCK
-CC2/3 in COS-7 cells, followed by
anti-FLAG immunoprecipitation and Western blot analysis with anti-HA
antibody to stain for coimmunoprecipitated HA-CC2/3. As shown in Fig.
8A, HA-MRCK
-CC2/3 was only detectable in FLAG-MRCK
-CAT1-473 immunoprecipitate when expressed
at higher levels. In contrast, the interaction between inactive
FLAG-MRCK
-KDK106A,1-473 and HA-CC2/3 was readily
detectable (Fig. 8A). The decline in affinity toward the negative
autoregulatory domain in the active kinase implies that the active form
is less prone to autoinhibition and, once activated, stays persistently
active, possibly as a consequence of autophosphorylation.

View larger version (34K):
[in this window]
[in a new window]
|
FIG. 8.
Kinase dimerization and kinase-CC2/3 interactions are
mutually exclusive. (A) Constant amounts of plasmids encoding
FLAG-KD or FLAG-CAT were cotransfected with increasing
concentrations of an HA-tagged CC2/3 construct (top) in COS-7
cells. Immunoprecipitated (IP) products were obtained with anti-FLAG
antibody and Western blotted (WB) with anti-HA or anti-FLAG antibodies.
(B) COS-7 cells were triply transfected with constant levels of HA-KD
and FLAG-KD plasmids together with increasing concentrations of the
HA-CC2/3 construct. The expression levels of HA-MRCK -KD and
HA-MRCK -CC2/3 are shown on the left.
|
|
We therefore tested the possibility that the kinase dimerization
process is under the regulation of the negative autoregulatory domain.
As shown in Fig. 8B, N terminus-dependent dimerization could be
inhibited by interaction between the kinase domain and the CC2/3
region. In this experiment, COS-7 cells were triply transfected with
fixed levels of both HA- and FLAG-MRCK
-KDK106A,1-473,
together with increasing levels of HA-MRCK
-CC2/3. In the absence or
at low concentration of HA-MRCK
-CC2/3,
HA-MRCK
-KDK106A,1-473 could be readily detected
in anti-FLAG immunoprecipitates, as a result of kinase dimerization. By
contrast, in the presence of higher concentrations of HA-MRCK
-CC2/3,
HA-MRCK
-KDK106A,1-473 was weakly detectable, which is
evidence of a lack of a kinase dimerization event. Taken together, our
findings show that N terminus-dependent dimerization and CC-mediated
inhibition are two mutually exclusive processes that determine the
catalytic state of MRCK
.
Coexpression of a kinase domain mutant capable of disrupting
CC-kinase interaction or treatment of cells with PMA caused MRCK kinase
activation in vivo.
Our results thus far have revealed that the
kinase domain of MRCK
can interact intramolecularly with the
negative autoregulatory CC2/3 region to form a closed conformation that
is low in catalytic activity. To further substantiate this point, we
tested if the disruption of this specific interaction would give rise
to active MRCK
. HA-MRCK
was coexpressed with
FLAG-MRCK
-
N-KDK106A,70-473 (deficient in catalytic
activity and N terminus-mediated dimerization) in COS-7 cells and
subjected to anti-FLAG immunoprecipitation and kinase assays.
FLAG-MRCK
-
N-KDK106A,70-473 would be predicted to
compete with the kinase domain of HA-MRCK
for interaction with the
CC2/3 region, and this, in turn, may lead to an opened conformation
with increases in catalytic activity. As shown in Fig.
9A (lane 4), detection of HA-MRCK
in
the FLAG-MRCK
-
N-KDK106A,70-473 immunoprecipitate
provided evidence that FLAG-MRCK
-
N-KDK106A,70-473
could indeed compete for the CC2/3 region. Interestingly, we also
observed that the coimmunoprecipitated HA-MRCK
(Fig. 9A, lane 4)
exhibited threefold higher activity than the control HA-MRCK
immunoprecipitated by anti-HA antibody (Fig. 9A, lane 3). These results
support the hypothesis that activation of MRCK
can be achieved by
disruption of the preexisting kinase domain-CC interaction.



View larger version (54K):
[in this window]
[in a new window]
|
FIG. 9.
Activation of MRCK by interactive binding to distal CC
and CRD. (A) COS-7 cells were transfected with either the
pXJ40-HA-MRCK (lane 1), the
FLAG-MRCK - N-KDK106A,70-473 (lane 2), the HA-MRCK
(lane 3), or the HA-MRCK plus the
FLAG-MRCK - N-KDK106A,70-473 (lane 4) construct.
Immunoprecipitations (IP) were carried out using either anti-HA or
anti-FLAG antibody (Ab) as indicated. Immunoprecipitated products were
subjected to kinase assay using GST-MLC2 (left). The phosphorylation
levels quantified are expressed as means and standard errors of
activities relative to that of HA-MRCK (lane 3; right). W/T, wild
type; WB, western blot. (B) Phorbol ester binding for MRCK -CRD. GST
fusion proteins were incubated with [3H]PDBu in the
presence or absence of phosphatidylserine (PS) as described in
Materials and Methods. The values shown are the means and standard
deviations from three independent experiments. (C) Serum-starved and
unstarved HeLa cells were treated either with 0.01% dimethylsulfoxide
(control) or with PMA at 300 ng/ml in dimethylsulfoxide for 30 min. The
endogenous MRCK was immunoprecipitated using an anti-MRCK antibody and
subjected to kinase assays using GST-MLC2 as the substrate (left).
Quantified GST-MLC2 phosphorylation levels are shown on the right as
means and standard errors of activities relative to that of the MRCK
immunoprecipitated from control serum-starved cells. (D) Concentrated
extracts of serum-starved HeLa cells were preincubated with either 1%
dimethylsulfoxide (control) or 0.5 µM PMA in the presence of 2 mM ATP
and 2 µg of PS at 30°C for 20 min. The endogenous MRCK was then
immunoprecipitated and subjected to kinase assays as previously
described (left). Quantified GST-MLC2 phosphorylation levels are shown
as means and standard errors of activities relative to that of the
control from three independent experiments (right).
|
|
It is therefore of interest to identify any physiological activator(s)
that may mimic this regulatory catalytic action of MRCKs in vivo. The
presence of the PBD and CRD in the C-terminal regulatory half of MRCKs
suggests possible roles for Cdc42 and diacylglyerol (DAG). We have
previously shown that overexpression of active Cdc42G12V
failed to activate overexpressed MRCK
(27). We had also
observed a lack of effect of Cdc42G12V on the activity of
endogenous MRCKs (data not shown). This is in contrast to PAK, whose
activity is dependent on p21 binding (48). The difference
between MRCK and PAK in Cdc42-mediated activation can be best explained
by the locations of their respective PBDs. The binding of Cdc42-GTP to
the PBD of PAK, located adjacent to its autoinhibitory domain, has been
shown to release the negative constraint exerted by autoinhibition
(25, 48). As for MRCK, the PBD located at the extreme
C-terminal end may, possibly, have little or no effect on the negative
autoregulatory CC2/3 domain.
The position of MRCK-CRD, in close proximity to the CC2/3 region,
suggests that specific ligand interactions at this site may be a better
candidate motif for kinase activation. We therefore examined the
interaction between MRCK
-CRD and phorbol ester (a DAG analog). As
shown in Fig. 9B, [3H]PDBu bound to GST-MRCK
-CRD in a
phosphatidylserine-dependent manner, comparable with
-chimaerin, a
member of the chimaerin family which is known to interact with and be
regulated by phorbol ester (1). We then tested the effect
of phorbol ester treatment of cells on endogenous MRCK activity.
Immunoprecipitates from HeLa cells exposed to PMA exhibited about
threefold higher kinase activity than the control cells cultured both
in serum and under serum-free conditions (Fig. 9C). However,
cross-linking of BS3 with PMA-treated and control cell
extracts did not reveal any differences in the molecular size of the
MRCK complex (data not shown), suggesting that PMA treatment did not
alter the overall complexity of the kinase. To test if PMA binding is
sufficient to induce MRCK activation, a cell-free assay was carried
out. As shown in Fig. 9D, the endogenous MRCK immunoprecipitated from serum-starved HeLa cell extracts preincubated with PMA consistently showed about onefold higher activity than the control untreated extracts. The lower extent of activation observed may be due to unoptimized in vitro conditions. Inclusion of recombinant Rho-GAP proteins such as RhoGAP190 and BCR had no obvious effects on the PMA
activation of MRCK in this cell-free system (data not shown). This
suggests that RhoGTPases are not involved in PMA-dependent kinase
activation. Taken together, these findings suggest that MRCK kinase can
be activated upon PMA binding, which possibly disrupted the preexisting
kinase domain-distal inhibitory CC interaction.
 |
DISCUSSION |
In this report, we have shown that native MRCK has the
intrinsic capacity of forming oligomers. The elution profile of MRCK from gel filtration chromatography suggests that the majority of MRCK
exists as tetrameric complexes (~900 kDa), with a minor pool of the
dimeric form (~500 kDa). The ability of the entire CC domain to
self-interact and the specific interactions observed for the smaller
individual CC1 and CC2 domains indicate that MRCK
multimers are
formed through parallel intermolecular interaction of the CC domains.
We also determined that the conserved N terminus of MRCK is responsible
for the dimerization of the kinase domain. Symmetric arrangement or
parallel orientation of MRCK
molecules in the complex supports a
novel dimerization role of the conserved N-terminal sequence. Our data
are consistent with the idea that MRCKs are maintained in a quaternary
structure through intermolecular interaction of the CC domain and the
conserved N-terminal sequence.
We found that the catalytic activity of MRCK
is critically dependent
on N terminus-mediated kinase domain dimerization and the subsequent
transautophosphorylation events. This phenomenon is now generally known
to be an activation mechanism that is common to many protein kinases.
Examples include nonreceptor and receptor tyrosine kinases, as well as
serine/threonine kinases. A well-studied case is the binding of a
dimeric platelet-derived growth factor to its receptor that induces the
formation of a symmetric dimer of the receptor kinase
(46), and other examples include Fes (37) and
double-stranded-RNA-dependent protein kinase (47), all of
which have been reported to depend on
dimerization-transautophosphorylation for activation. Despite adopting
a similar dimerization-activation mechanism, the specific domains
responsible for dimerization in the different kinases appear to be
diverse. In the case of MRCK, the unique N-terminal sequence is
conserved among MRCK
and -
isoforms, ROK, and DMPK. More
importantly, functional conservation as a dimerization motif extends to
an unrelated plant DNA-binding protein, GT1a (24). Given
the similarity in the domain arrangements, as well as the conservation
of the potential phosphorylation sites within the kinase activation
loops and the extended hydrophobic phosphorylation motif, it is
conceivable that N terminus-mediated kinase dimerization could also be
an integral part of ROK and DMPK activation. In support of this,
deletion of the N-terminal sequence from ROK resulted in an inactive
enzyme (26).
Apart from the multimerization property, the CC2/3 region was also
found to act as a negative autoregulatory domain in regulating MRCK
kinase activity by forming a stable complex with the kinase domain.
Besides possible blockage of substrate and ATP binding, as described
for many kinases (20), our results raise the
possibility of an additional mode of inhibition in which the formation
of the stable kinase domain-distal CC2/3 interaction prevents N
terminus-mediated kinase dimerization-kinase activation from taking
place (Fig. 8B). The active MRCK
kinase domain (presumably in
the phosphorylated state) exhibited a marked reduction in
affinity toward the CC2/3 region (Fig. 8A). These findings imply that
the intramolecular kinase domain-CC2/3 interaction and intermolecular N
terminus-dependent kinase dimerization are mutually exclusive and that
the catalytic state of MRCK
is determined by the interplay of these
two events.
We have also identified phorbol ester as an activator of MRCK. The
finding of direct phorbol ester binding and activation of MRCK adds the
kinase to the growing list of characterized intracellular phorbol ester
receptors, such as protein kinase C, DAG kinase, n-chimaerin, Vav, and Ras guanyl nucleotide-releasing
protein (12, 16, 42). This has rendered the mechanism of
phorbol ester effects on cellular activities more diverse and
complicated than first anticipated. However, the exact in vivo function
of MRCK in phorbol ester-induced morphological effects is not clear, as
dominant negative constructs of MRCK were not effective in blocking
PMA-dependent ruffling (data not shown). Further experiments are
therefore required to clarify the exact role of MRCK on morphological events induced by phorbol ester.
From the observations so far, we propose a model for phorbol
ester-dependent activation of MRCK (Fig.
10). When cells are in the resting
state, MRCK is kept inactive in a closed conformation by the
interaction between the kinase domain and the negative autoregulatory
CC2/3 domain. Interaction of PMA with the CRD of MRCK initiates the
disruption of the performed kinase domain-distal CC2/3 interaction,
releasing the kinase domain to allow N terminus-mediated dimerization
and kinase activation. This model is compatible with the recent reports
of autoregulation of the related Rho kinase (3) and DMPK
(8). The autoinhibitory domain of Rho kinase was mapped
within the C-terminal half of the protein, and Rho-GTP binding to the
Rho binding site located at the end of the distal CC region has been
shown to activate ROK kinase activity, presumably by releasing the
constraint of the autoinhibitory event (3). It is of
interest that the MRCK's CRD motif responsible for phorbol ester
binding is also located at a position similar to that of the Rho
binding site in Rho kinase (27). Similarly, a
pseudosubstrate-like autoinhibitory domain after the C-terminal CC of
DMPK and a correlation of the CC-mediated oligomerization with
catalytic activity was recently described (8). It is
conceivable that all of these related kinases have adopted a similar
mechanism by which to regulate their catalytic activities through
inter- and intramolecular interactions, although the exact natures of
the interactions may differ. It remains to be seen whether this
fundamental regulatory mechanism is conserved among all of these
related kinases.

View larger version (22K):
[in this window]
[in a new window]
|
FIG. 10.
Model for regulation of the catalytic activity of
MRCK . The intramolecular interaction between the CC autoinhibitory
domain CC2-CC3 and the kinase domain keeps the kinase in a closed,
inactive, dimeric structure. Disruption of this interaction (e.g., PMA
binding to the CRD or coexpression with a mutant kinase domain)
resulted in an open structure that facilitates N terminus-mediated
dimerization, autophosphorylation, and subsequent kinase activation.
|
|
| 1.
|
Ahmed, S.,
J. Lee,
R. Kozma,
A. Best,
C. Monfries, and L. Lim.
1993.
A novel functional target for tumor-promoting phorbol esters and lysophosphatidic acid. The p21rac-GTPase activating protein n-chimaerin.
J. Biol. Chem.
268:10709-10712[Abstract/Free Full Text].
|
| 2.
|
Amano, M.,
K. Chihara,
N. Nakamura,
Y. Fukata,
T. Yano,
M. Shibata,
M. Ikebe, and K. Kaibuchi.
1998.
Myosin II activation promotes neurite retraction during the action of Rho and Rho-kinase.
Genes Cells
3:177-188[Abstract].
|
| 3.
|
Amano, M.,
K. Chihara,
N. Nakamura,
T. Kaneko,
Y. Matsuura, and K. Kaibuchi.
1999.
The COOH terminus of Rho-kinase negatively regulates Rho-kinase activity.
J. Biol. Chem.
274:32418-32424[Abstract/Free Full Text].
|
| 4.
|
Aslanidis, C.,
G. Jansen,
C. Amemiya,
G. Shutler,
M. Mahadevan,
C. Tsilfidis,
C. Chen,
J. Alleman,
N. G. M. Wormskamp,
M. Vooijs,
B. Jessica,
K. Johnson,
H. J. M. Smeets,
G. G. Lennon,
A. V. Carrano,
R. G. Korneluk,
B. Wieringa, and P. J. de Jong.
1992.
Cloning of the essential myotonic dystrophy region and mapping of the putative defect.
Nature
355:548-551[CrossRef][Medline].
|
| 5.
|
Atkinson, S. J., and M. Stewart.
1992.
Molecular interactions in myosin assembly. Role of the 28-residue charge repeat in the rod.
J. Mol. Biol.
226:7-13[CrossRef][Medline].
|
| 6.
|
Bi, E., and S. H. Zigmond.
1999.
Actin polymerization: where the WASP stings.
Curr. Biol.
9:R160-R163[CrossRef][Medline].
|
| 7.
|
Bishop, A., and A. Hall.
2000.
Rho GTPases and their effector proteins.
Biochem. J.
348:241-255.
|
| 8.
|
Bush, E. W.,
S. M. Helmke,
R. A. Birnbaum, and M. B. Perryman.
2000.
Myotonic dystrophy protein kinase domains mediate localization, oligomerization, novel catalytic activity, and autoinhibition.
Biochemistry
39:8480-8490[CrossRef][Medline].
|
| 9.
|
Chan, T. O.,
S. E. Rittenhouse, and P. N. Tsichlis.
1999.
AKT/PKB and other D3 phosphoinositide-regulated kinases: kinase activation by phosphoinositide-dependent phosphorylation.
Annu. Rev. Biochem.
68:965-1014[CrossRef][Medline].
|
| 10.
|
Chen, X.-Q.,
I. Tan,
T. Leung, and L. Lim.
1999.
The myotonic dystrophy kinase-related Cdc42-binding kinase is involved in the regulation of neurite outgrowth in PC12 cells.
J. Biol. Chem.
274:19901-19905[Abstract/Free Full Text].
|
| 11.
|
Chihara, K.,
M. Amano,
N. Nakamura,
T. Yano,
M. Shibata,
T. Tokui,
H. Ichikawa,
R. Ikebe,
M. Ikebe, and K. Kaibuchi.
1997.
Cytoskeletal rearrangements and transcriptional activation of c-fos serum response element by Rho-kinase.
J. Biol. Chem.
272:25121-25127[Abstract/Free Full Text].
|
| 12.
|
Ebinu, J. O.,
D. A. Bottorff,
E. Y. W. Chan,
S. L. Stang,
R. J. Dunn, and J. C. Stone.
1998.
RasGRP, a Ras guanyl nucleotide-releasing protein with calcium- and diacylglycerol-binding motifs. 1998.
Science
280:1082-1086[Abstract/Free Full Text].
|
| 13.
|
Fu, Y.-H.,
A. Pizzuti,
G. Fenwick, Jr.,
J. King,
S. Rajnarayan,
P. W. Dunne,
J. Dubel,
G. A. Nasser,
T. Ashizawa,
P. J. de Jong,
B. Wieringa,
R. Korneluk,
M. B. Perryman,
H. F. Epstein, and C. T. Caskey.
1992.
An unstable triplet repeat in a gene related to myotonic muscular dystrophy.
Science
255:1256-1258[Abstract/Free Full Text].
|
| 14.
|
Gallo, G., and P. C. Letourneau.
1998.
Axon guidance: GTPases help axons reach their targets.
Curr. Biol.
8:R80-R82[CrossRef][Medline].
|
| 15.
|
Goto, H.,
H. Kosako,
K. Tanabe,
M. Yanagida,
M. Sakurai,
M. Amano,
K. Kaibuchi, and M. Inagaki.
1998.
Phosphorylation of vimentin by Rho-associated kinase at a unique amino-terminal site that is specifically phosphorylated during cytokinesis.
J. Biol. Chem.
273:11728-11736[Abstract/Free Full Text].
|
| 16.
|
Gulbins, E.,
K. M. Coggeshall,
G. Baier,
D. Telford,
C. Langlet,
G. Baier-Bitterlich,
N. Bonnefoy-Berard,
P. Burn,
A. Wittinghofer, and A. Altman.
1994.
Direct stimulation of Vav guanine nucleotide exchange activity for Ras by phorbol ester and diglycerides.
Mol. Cell. Biol.
14:4749-4758[Abstract/Free Full Text].
|
| 17.
|
Hall, A.
1998.
Rho GTPases and the actin cytoskeleton.
Science
279:509-514[Abstract/Free Full Text].
|
| 18.
|
Hirose, M.,
T. Ishizaki,
N. Watanabe,
M. Uehata,
O. Kranenburg,
W. H. Moolenaar,
F. Matsumura,
M. Maekawa,
H. Bito, and S. Narumiya.
1998.
Molecular dissection of the Rho-associated protein kinase (p160ROCK)-regulated neurite remodeling in neuroblastoma N1E-115 cells.
J. Cell Biol.
141:1625-1636[Abstract/Free Full Text].
|
| 19.
|
Ishizaki, T.,
M. Maekawa,
K. Fujisawa,
K. Okawa,
A. Iwamatsu,
A. Fujita,
N. Watanabe,
Y. Saito,
A. Kakizuka,
N. Morii, and S. Narumiya.
1996.
The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.
EMBO J.
15:1885-1893[Medline].
|
| 20.
|
Kemp, B. E.,
M. W. Parker,
S. Hu,
T. Tiganis, and C. House.
1994.
Substrate and pseudosubstrate interactions with protein kinases: determinants of specificity.
Trends Biochem. Sci.
19:440-444[CrossRef][Medline].
|
| 21.
|
Kosako, H.,
H. Goto,
M. Yanagida,
K. Matsuzawa,
M. Fujita,
Y. Tomono,
T. Okigaki,
H. Odai,
K. Kaibuchi, and M. Inagaki.
1999.
Specific accumulation of Rho-associated kinase at the cleavage furrow during cytokinesis: cleavage furrow-specific phosphorylation of intermediate filaments.
Oncogene
18:2783-2788[CrossRef][Medline].
|
| 22.
|
Kozma, R.,
S. Sarner,
S. Ahmed, and L. Lim.
1997.
Rho family GTPases and neuronal growth cone remodeling: relationship between increased complexity induced by Cdc42Hs, Rac1, and acetylcholine and collapse induced by RhoA and lysophosphatidic acid.
Mol. Cell. Biol.
17:1201-1211[Abstract].
|
| 23.
|
Kuroda, S.,
M. Fukata,
M. Nakagawa,
K. Fujii,
T. Nakamura,
T. Ookubo,
I. Izawa,
T. Nagase,
N. Nomura,
H. Tani,
I. Shoji,
Y. Matsuura,
S. Yonehara, and K. Kaibuchi.
1998.
Role of IQGAP1, a target of the small GTPases Cdc42 and Rac1, in regulation of E-cadherin-mediated cell-cell adhesion.
Science
281:832-835[Abstract/Free Full Text].
|
| 24.
|
Lam, E.
1995.
Domain analysis of the plant DNA-binding protein GT1a: requirement of four putative -helices for DNA binding and identification of a novel oligomerization region.
Mol. Cell. Biol.
15:1014-1020[Abstract].
|
| 25.
|
Lei, M.,
W. Lu,
W. Meng,
M.-C. Parrini,
M. J. Eck,
B. J. Mayer, and S. C. Harrison.
2000.
Structure of PAK in an autoinhibited conformation reveals a multistage activation switch.
Cell
102:387-397[CrossRef][Medline].
|
| 26.
|
Leung, T.,
X.-Q. Chen,
E. Manser, and L. Lim.
1996.
The p160 RhoA-binding kinase ROK is a member of a kinase family and is involved in the reorganization of the cytoskeleton.
Mol. Cell. Biol.
16:5313-5327[Abstract].
|
| 27.
|
Leung, T.,
X.-Q. Chen,
I. Tan,
E. Manser, and L. Lim.
1998.
Myotonic dystrophy kinase-related Cdc42-binding kinase acts as a Cdc42 effector in promoting cytoskeletal reorganization.
Mol. Cell. Biol.
18:130-140[Abstract/Free Full Text].
|
| 28.
|
Lim, L.,
E. Manser,
T. Leung, and C. Hall.
1996.
Regulation of phosphorylation pathways by p21 GTPases: the p21 Ras-related Rho subfamily and its role in phosphorylation signaling pathways.
Eur. J. Biochem.
242:171-185[Medline].
|
| 29.
|
Luo, L.,
T. Lee,
L. Tsai,
G. Tang,
L. Y. Jan, and Y.-N. Jan.
1997.
Genghis Khan (Gek) as a putative effector for Drosophila Cdc42 and regulator of actin polymerization.
Proc. Natl. Acad. Sci. USA
94:12963-12968[Abstract/Free Full Text].
|
| 30.
|
Maeda, M.,
C. S. Taft,
E. W. Bush,
H. Emma,
W. M. Bailey,
H. Neville,
M. B. Perryman, and R. D. Bies.
1995.
Identification, tissue-specific expression, and subcellular localization of the 80- and 71-kDa forms of myotonic dystrophy kinase protein.
J. Biol. Chem.
270:20246-20249[Abstract/Free Full Text].
|
| 31.
|
Manser, E.,
H.-Y. Huang,
T.-H. Loo,
X.-Q. Chen,
J.-M. Dong,
T. Leung, and L. Lim.
1997.
Expression |