Previous Article | Next Article ![]()
Molecular and Cellular Biology, April 2005, p. 3127-3139, Vol. 25, No. 8
0270-7306/05/$08.00+0 doi:10.1128/MCB.25.8.3127-3139.2005
Copyright © 2005, American Society for Microbiology. All Rights Reserved.
,
Clare Hall Laboratories, London Research Institute, Cancer Research UK, South Mimms, Hertfordshire, United Kingdom
Received 26 November 2004/ Returned for modification 27 December 2004/ Accepted 24 January 2005
|
|
|---|
|
|
|---|
Many of the genes required for meiotic recombination also function in the repair of DSBs generated following exposure to DNA-damaging agents or arising following the collapse of stalled replication forks. The importance of these genes in preventing genome instability is highlighted by the plethora of human cancer susceptibility syndromes that arise from defects in DNA repair genes (20). For example, inherited mutations in the DNA repair gene BRCA2 lead to an enhanced predisposition to breast, ovarian, and other cancers (37). Defects in BRCA2 are also responsible for the D1 complementation group of Fanconi anemia, an autosomal recessive disorder characterized by cancer predisposition, congenital defects, progressive bone marrow failure, and hypersensitivity to DNA cross-linking agents, such as cisplatin and mitomycin C (16). It is widely accepted that BRCA2 functions in the homologous recombination (HR) pathwayan error-free mechanism of DSB repair (DSBR) that utilizes an intact sister or homologous chromosome to repair breaks in DNA (19, 45). In the absence of HR, gross chromosomal rearrangements, such as deletions and translocations, result from error-prone repair of spontaneous DSBs (17). Such gross chromosomal rearrangements are the hallmark of BRCA2-defective cells (44, 51).
Accumulating evidence supports a direct role for BRCA2 in HR, where it functions as a regulator of RAD51 (46). First, BRCA2 and RAD51 proteins colocalize extensively at sites of DSBs, suggesting that they may form a complex in vivo (10). The 3,418-amino-acid human BRCA2 protein binds directly to RAD51 through a BRC motif that is repeated eight times within the central region of the protein (11, 49). Overexpression of the BRC4 motif in cell cultures confers a dominant-negative radiation-sensitive phenotype and an inability to form RAD51 foci at gamma irradiation-induced DSBs (9). Similarly, mutant cell lines harboring truncations in BRCA2 are radiation sensitive, fail to form RAD51 foci at DSBs, and are severely compromised in the homology-directed repair of DSBs (29, 32, 52). Finally, peptides corresponding to the BRC3 or BRC4 motif also block RAD-51 multimerization, forcing it into a monomeric state that is unable to bind DNA or perform recombination reactions in vitro (14). Together with the observation that RAD51 is predominantly cytoplasmic in the absence of BRCA2, it has been speculated that BRCA2 imposes two levels of control over RAD51 function by regulating its cellular localization and modulating its repair activities (19, 46). However, the mechanism by which this control occurs and whether BRCA2 performs a similar role in meiotic recombination are not known.
Five distinct structural domains have been identified in the cocrystal structure of the C-terminal region of BRCA2 bound to DSS1, a highly conserved 70-amino-acid acidic protein shown previously to bind to BRCA2 (30, 50). These include a helical region, three oligonucleotide-oligosaccharide binding (OB) folds that are also present in ssDNA binding proteins such as RPA, and a tower-like extension from OB fold 2 that may bind to double-stranded DNA (dsDNA). A simplified version of BRCA2 has been identified in the fungus Ustilago maydis (Brh2); it possesses a single BRC motif and a C-terminal conserved region containing two OB folds, including the tower-like extension found in OB fold 2 of the human protein (21). Brh2 and the single Dss1 homolog in U. maydis function in the Rad51 pathway for HR, as their combined disruption results in epistatic DNA repair and meiotic recombination defects (22). Meiotic defects also arise in the absence of Arabidopsis thaliana BRCA2, adding further support to a conserved role for BRCA2 orthologs in meiotic recombination (41). At present, very little is known about the role of BRCA2 in meiotic recombination other than that it plays a role in the Rad51 pathway.
The work presented here describes the identification of a BRCA2-related protein of Caenorhabditis elegans (CeBRC-2). Although CeBRC-2 is only a little over a tenth the size of its human counterpart, it possesses a single BRC domain, an OB fold, and two putative nuclear localization signals (NLSs) that are hallmarks of BRCA2 proteins (25). We propose that CeBRC-2 is functionally related to BRCA2 in human cells based on the observations that CeBRC-2 binds directly to RAD-51 and ssDNA and that Cebrc-2 mutants fail to repair meiotic and radiation-induced DSBs by HR due to an inability to correctly regulate RAD-51. Importantly, these studies also reveal fundamental differences between Cebrc-2 and rad-51 mutants that may indicate previously unknown functions for BRCA2-related genes in DNA repair.
|
|
|---|
Sequence alignments. Protein sequences were aligned by using Pileup and refined by using the Lineup algorithm (Genetics Computer Group). Multiple sequence files were exported to ESPript 2.0 at http://prodes.toulouse.inra.fr/ESPript/cgi-bin/nph-ESPript_exe.cgi for box-shading analysis.
Gateway recombinational cloning. Open reading frame-specific primers compatible with the Gateway system (Invitrogen) were designed for Cebrc-2 and cloned into Entry as previously described (47). The sequences of primers used for Cebrc-2 cDNA amplification can be found at http://worfdb.dfci.harvard.edu/search.pl?form=1&search=T07E3.5. Gateway LR destination cloning was used to transfer Cebrc-2 cDNA into pAD-Amp and pDB-Amp (for yeast two-hybrid analysis), pDEST-CMV-Flag and pDEST-CMV-Myc (for protein expression in 293T cells), and pSB_GW::TAG (for generating integrated transgenic lines).
Protein interaction assays. The yeast two-hybrid methods used were previously described (5). To test pair-wise interactions in yeast cells, Gal4 DNA binding domain and activation domain fusions were used to cotransform yeast strain MAV103. Interactions for each combination were tested by scoring for yeast two-hybrid phenotypes (LacZ and Ura) at 30°C as described previously (5).
To test for interactions directly with recombinant proteins, BL21(DE3) codon plus bacterial strains were transformed with pET22_rad-51, pET28_brc-2-6His, and/or pET28_brc-2. Protein expression was induced for 3 h at 30°C with 0.5 mM isopropyl-ß-D-thiogalactopyranoside (IPTG). Cells were harvested, lysed in TLB (50 mM sodium phosphate [pH 7.0], 20 mM imidazole, 250 mM NaCl, 10% glycerol, protease inhibitor cocktail [Invitrogen]), and treated with 5 µg of DNase I (Sigma)/ml prior to clarification of extracts at 42,000 x g in a Beckman ultracentrifuge for 30 min. Extracts were incubated with preequilibrated Talon beads for 30 min at 4°C before being washed three times with TLB. Proteins associated with the beads were subjected to 10% polyacrylamide gel electrophoresis (PAGE) and then visualized by Coomassie brilliant blue staining.
To test for interactions in tissue culture cells, 293T cells were transiently transfected with pDEST-CMV_Flag-brc-2, pDEST-CMV_Myc-rad-51, or pDEST-CMV_Myc constructs by using Lipofectamine 2000 (Gibco BRL). At 72 h posttransfection, cells were harvested, lysed in ELB250 (50 mM HEPES [pH 7.0], 250 mM NaCl, 0.5% NP-40, 0.5 mM EDTA, 1 mM phenylmethylsulfonyl fluoride, 0.5 mM NaF, 0.1 mM Na2VO3, 0.5 mM dithiothreitol [DTT], protease inhibitor cocktail), and treated with 5 µg of DNase I/ml prior to clarification of extracts at 42,000 x g in a Beckman ultracentrifuge for 30 min. Extracts were incubated with monoclonal antibody (MAb) 9E10 (Myc) or M2 (Flag) coupled to beads for 30 min at 4°C before being washed three times with ELB250. Proteins associated with the beads were subjected to electrophoresis and then Western blotting with MAb 9E10 (Myc) or M2 (Flag) as previously described (6).
To test for an interaction between CeBRC-2 and RAD-51 by coimmunoprecipitation from C. elegans extracts, the pSB_Pbrc-2brc-2::HA_8xHis_TEV_Myc transgene was delivered into unc-119 (ed3) by microparticle bombardment, and the dwIs7-transformed line was selected as previously described (36). Extracts prepared from N2 (wild-type) and dwIs7 C. elegans strains were incubated with MAb 9E10 (Myc) or 12CA5 (hemagglutinin [HA]) coupled to beads for 30 min at 4°C before being washed three times with lysis buffer as previously described (35). Proteins associated with the beads were subjected to electrophoresis and then Western blotting with antibody to BRC-2 or RAD-51.
CeBRC-2 protein purification. BL21(DE3) codon plus bacteria were transformed with pET28_brc-2-6His and used to inoculate 20 liters of fermenter broth (32 g of Bacto tryptone/liter, 20 g of Bacto yeast extract/liter, 5 g of NaCl/liter, 10 g of K2HPO4/liter, 1.85 g of KH2PO4/liter, 50 µg of kanamycin/ml, 25 µg of chloramphenicol/ml) in a 40-liter BioFlow500 fermenter (New Brunswick). Protein expression was induced with 1 mM IPTG at 16°C overnight. Cells were harvested, and 10 g of cell pellet was resuspended in lysis buffer (50 mM NaP [pH 7.0], 500 mM NaCl, 10% glycerol) and lysed with a French press. Extracts were incubated with 2 µg of DNase I/ml for 1 h before centrifugation. CeBRC-2(His6) was purified by ammonium sulfate precipitation (final concentration, 66%), Talon affinity chromatography (elution with a 50 to 500 mM imidazole gradient), and heparin chromatography. Peak CeBRC-2(His6) fractions were pooled and dialyzed against protein storage buffer (20 mM Tris-acetate [pH 7.5], 200 mM potassium acetate, 10% glycerol, 1 mM EDTA, 0.5 mM DTT). Purified CeBRC-2(His6) is devoid of nuclease contamination and, following sodium dodecyl sulfate (SDS)-PAGE, is the only protein detected by silver staining.
DNA binding assays. Binding reaction mixtures (10 µl) contained 5'-32P-end-labeled DNA substrates (0.5 ng or 0.15 nM) and various amounts of CeBRC-2 in binding buffer (50 mM Tris-HCl [pH 8.0], 5 mM EDTA, 1 mM DTT, 100 µg of bovine serum albumin/ml, 6% glycerol). After 10 min of incubation at room temperature, products were analyzed by 4% PAGE with Tris-borate-EDTA buffer and visualized by autoradiography. The 5'-32P-end-labeled 100-mer and complementary oligonucleotides were prepared as described previously (31). Samples (see Fig. 2F; see also Fig. S1A in the supplemental material) were resolved for 1 h and for 3 h at 100 V, respectively; it was necessary to resolve some of the protein-DNA complexes (see Fig. S1A in the supplemental material) for a longer time in order to observe the supershifted complexes with the His antibody.
![]() View larger version (30K): [in a new window] |
FIG. 2. CeBRC-2 and RAD-51 interact directly in vitro and in vivo. (A) The yeast two-hybrid system was used to test for protein interactions among RAD-51, RAD-51D, CeBRC-2 (residues 1 to 114), CeBRC-2 (1 to 250), CeBRC-2 (full length [FL]), CeBRC-2 (114 to 394), RPA-1, RPA-2, and MRT-2 fused to either the DNA binding domain (DB) or the activation domain (AD) of GAL4 by scoring for lacZ expression. Controls: 1, DB-DP and AD-E2F1; 2, Gal4p and AD; 3, DB-Fos and AD-Jun; 4, DB-pRB and AD-E2F1; and 5, DB and AD without any fusion (5). Lane M, markers. (B) CeBRC-2, CeBRC-2(His6), and RAD-51 were expressed in E. coli (10% of the whole-cell extracts used in the pull-down assays is shown in lanes 1 to 4), and pull-down assays were performed with whole-cell extracts and Talon beads, which specifically bind to proteins containing polyhistidine tracks. RAD-51 was pulled down on Talon beads with full-length C-terminal histidine-tagged Ce-BRC-2 (lane 8) but not when expressed alone (lane 7) or with untagged CeBRC-2 (lane 9). Pull-down assay samples were resolved by SDS-12% PAGE and stained with Coomassie brilliant blue. (C) Flag-tagged CeBRC-2 was coimmunoprecipitated with anti-Myc MAb 9E10 when coexpressed in 293T cells with CMV_Myc-RAD-51 (lane 5) but not with CMV_Myc (lane 3). WB, Western blot; IP, immunoprecipitation. Approximately 30% of Myc-RAD-51 in the extracts was pulled down with Flag-tagged CeBRC-2. (D) Ce-BRC-2 and RAD-51 were coimmunoprecipitated with anti-Myc MAb 9E10 (lane 3) and anti-HA MAb 12CA5 (lane 4) from extracts derived from the C. elegans dwIs7 (Pbrc-2brc-2::HA_8xHis_Tev_Myc) transgenic line, which expresses CeBRC-2 fused at the C terminus to HA_8xHis_Tev_Myc epitopes, but not from extracts derived from an untagged strain (lanes 1 and 2). Wt, wild type. We estimated that 30 to 35% of the RAD-51 pool in the extracts was pulled down with CeBRC-2. (E) Purified full-length recombinant CeBRC-2(His6). An SDS-12% PAGE analysis of purified CeBRC-2(His6) stained with Coomassie brilliant blue is shown. (F) DNA binding activity of CeBRC-2. DNA binding reactions with mixtures containing ssDNA or dsDNA and the indicated concentrations of CeBRC-2 were carried out as described in Materials and Methods. Protein-DNA complexes (indicated by an arrow) were analyzed by 4% PAGE. Asterisks indicate 5'-32P-end labels.
|
Peptide synthesis and production of antibodies. Peptides were synthesized (Peptide Synthesis Laboratory, Cancer Research UK) for antibody production (BRC-2N, N-CMGDSSKKVKDSFDTISEPD-C; BRC-2C, N-CWKDFGSYLKHKEDKKKRRS-C) and for microinjection (BRC_Wt, N-CDEPKGVPISMEPVFSTAAGIRIDVKQESIDKSKKMLNSDLKSKSSSKGGFSSPLVRKNNGSSAFVSPF-C; BRC_Mut, N-CDEPKGVPISMEPVFIDVKQESIDKSKKMLNSDLKSKSSSKGGFSSPLVRKNNGSSAFVSPF-C). For antibody production, 1 mg each of BRC-2N and BRC-2C peptides was coupled to activated keyhole limpet hemocyanin (Pierce, Rockford, Ill.) before injection into rabbits (Harlan Sera Labs, Loughborough, United Kingdom). Affinity purification of antibodies was performed by binding reacting antibodies from the crude serum to an immobilized peptide-Sulfolink matrix (Pierce). The column was washed extensively with coupling buffer prior to elution with Gentle Ag/Ab elution buffer (Pierce). Eluted antibodies were dialyzed against protein dilution buffer (20 mM Tris-HCl [pH 7.8], 200 mM potassium acetate, 10% glycerol, 1 mM EDTA, 0.5 mM DTT). Antibodies were tested by Western blotting against recombinant proteins expressed in Escherichia coli and then against C. elegans extracts. Extracts were generated from a pellet of frozen mixed-staged wild-type Bristol N2 worms by lysis in buffer A {7 M urea, 2 M thiourea, 4% 3-[(3-cholamidopropyl)-dimethylammonio]-1-propanesulfonate (CHAPS), 40 mM Tris, 65 mM DTT}.
Cytological preparation and immunostaining. Gravid hermaphrodites were transferred to 30 µl of phosphate-buffered saline (PBS) on poly-L-lysine-coated slides (slides were washed with 70% ethanol and then given two coats of 100% poly-L-lysine, with air drying between the coats). The worms were washed with PBS before being transferred to 50 µl of 10 mM levamisole. Germ lines were extruded by removing the head and tail with a fine-gauge (27-gauge) needle. Levamisole was replaced with 1% paraformaldehyde in PBS for 10 min. After fixation, the germ lines were permeabilized for 5 min in TBSB (Tris-buffered saline-0.5% bovine serum albumin)-0.1% Triton X-100 and washed with TBSB at least three times for 5 min each time, followed by blocking for 30 min. Primary antibodies were diluted in TBSB (1:500 for RPA-1, 1:100 for RAD-51, 1:50 for SYP-1, and 1:2,000 for CeBRC-2 antibodies) and incubated overnight at 4°C in a humid chamber. Germ lines were subsequently washed at least three times for 5 min each time with TBSB before incubation with secondary antibodies for 1 to 2 h at room temperature (antibodies to rabbit Cy3 at 1:10,000 or to guinea pig-fluorescein isothiocyanate at 1:10,000 [Sigma]). Finally, the germ lines were washed at least three times for 5 min each time with TBSB (second wash also containing 1 µg of 4',6'-diamidino-2-phenylindole [DAPI]/ml) before being mounted on coverslips with Vectashield.
Fluorescence microscopy. Deltavision microscopy was used to examine germ lines with either a x40 or a x63, 1.4 NA Planapochromat lens on an Olympus inverted microscope (IX71). Images were captured by using SoftWorx computer software (Applied Precision). Three-dimensional data sets were computationally deconvolved, and regions of interest were projected onto one dimension. Merged or single-color images were recorded by using GIMP software.
|
|
|---|
![]() View larger version (40K): [in a new window] |
FIG. 1. CeBRC-2 possesses a subset of conserved domains present in human BRCA2. A scaled representation of human BRCA2 compared with CeBRC-2 is shown at the top. The various conserved domains, including the BRC repeat region (red), the helical region (yellow), OB folds (green), the tower-like structure (blue), and putative NLSs (black-orange), are indicated. The single BRC motif (residues 9 to 114) in CeBRC-2 is situated at the N terminus of CeBRC-2. Two putative NLSs are located on either side of a single OB fold situated at the C terminus of the protein (residues 263 to 370). aa, amino acids. (A) Protein sequence alignment of the eight BRC motifs of BRCA2 (abbreviated brc1 to brc8) with the single BRC motif of CeBRC-2 (CeBRC-2_brc). Asterisks indicate the critical residues required for the BRC4-Rad51 interaction, as defined structurally (34). (B) Alignment of the OB fold domain of CeBRC-2 (CeBRC-2_OB fold) with the OB fold of RPA1 from six different species (At, A. thaliana; rice; Mus, mouse; Hs, human; Nc, Neurospora crassa; and Ce, C. elegans).
|
The presence of a single BRC motif, two NLSs, and an OB fold suggests that T07E3.5 may encode an ancestral BRCA2-related protein in C. elegans. We therefore refer to T07E3.5 as Cebrc-2.
RAD-51 interacts directly with CeBRC-2 in vitro and in vivo. To determine whether the BRC motif in CeBRC-2 is responsible for the association with RAD-51, we tested various regions of CeBRC-2 for interactions with RAD-51 by using the yeast-two hybrid system. Fragments of CeBRC-2 containing the BRC motif (amino acids 1 to 114) interact with RAD-51, as demonstrated by ß-galactosidase activity (Fig. 2A). The CeBRC-2 fragment containing amino acids 1 to 114 is also capable of interacting with the single C. elegans RAD51 paralog (RFS-1), but the relevance of this interaction is presently unclear. However, RPA-1, RPA-2, MRT-2, and a C-terminal fragment of CeBRC-2 (amino acids 114 to 394) with a deletion of the BRC motif do not interact with RAD-51. This result demonstrates that the BRC region of CeBRC-2 is responsible for binding to RAD-51. Thus, CeBRC-2 and RAD-51 interact in a manner similar to that reported for BRCA2 and RAD51 in human cells and BRCA2 and DMC1 in A. thaliana (11, 41). We also tested for a previously reported association between MRT-2 and CeBRC-2 (23) but were unable to detect this interaction in either orientation in the yeast two-hybrid system (Fig. 2A).
To determine whether the CeBRC-2-RAD-51 interaction is direct, we tested for an association between CeBRC-2 and RAD-51 coexpressed in either E. coli or tissue culture cells. Six-histidine-tagged CeBRC-2 pulls down RAD-51 from E. coli extracts (Fig. 2B; see Materials and Methods). Furthermore, Myc-tagged RAD-51 is coimmunoprecipitated with CeBRC-2 from 293T cell extracts by antibodies to the Myc epitope (Fig. 2C). Since the extracts derived from both E. coli and 293T cells coexpressing CeBRC-2 and RAD-51 were extensively treated with DNase I to remove DNA, the CeBRC-2-RAD-51 interaction is likely to be direct and to not require DNA.
To test whether this interaction occurs in vivo, we generated dwIs7, a transgenic C. elegans line that carries a single integrated copy of a PCebrc-2Cebrc-2::HA_8xHis_Tev_Myc transgene, as detected by Southern blotting, and that expresses CeBRC-2 fused to HA, eight His, and Myc epitopes under the control of its own promoter. Using antibodies to either the HA or the Myc epitope fused to CeBRC-2, we could coimmunoprecipitate RAD-51 with CeBRC-2 from extracts derived from the dwIs7 line but not from extracts made from the wild-type strain lacking the transgene (Fig. 2D). We conclude that RAD-51 and CeBRC-2 interact in vivo.
CeBRC-2 binds preferentially to ssDNA. To assess whether CeBRC-2 can bind to DNA and whether it has a preferred substrate in vitro, we used electrophoretic mobility shift assays. In these experiments, 32P-end-labeled ssDNA and dsDNA molecules were used as substrates for CeBRC-2 binding. Purified full-length recombinant CeBRC-2 (Fig. 2E) preferentially forms discrete protein-DNA complexes with ssDNA templates (Fig. 2F, lanes 1 to 4) but not with dsDNA templates (Fig. 2F, lanes 5 to 8) at equivalent concentrations of CeBRC-2. While protein-DNA complexes are readily detected between ssDNA and CeBRC-2 (111 nM), the detection of complexes with dsDNA required 20-fold-higher concentrations of CeBRC-2 (2,200 nM) (data not shown). Prebinding of CeBRC-2 with an antibody to the OB fold domain at the C terminus blocks the binding of CeBRC-2 to ssDNA, whereas an antibody that recognizes the His tag fused to the N terminus of CeBRC-2 supershifts the protein-DNA complexes (see Fig. S1A in the supplemental material). These results suggest that CeBRC-2 preferentially binds to ssDNA via its OB fold domain.
Embryonic lethality and meiotic recombination defects in Cebrc-2 mutants. Truncating mutations in mammalian BRCA2 lead to spontaneous chromosomal rearrangements and radiosensitivity due to an inability to repair DSBs correctly via the HR pathway (44, 51). Consistent with a conserved function for BRCA2-related genes in DSBR processes, deletion of U. maydis Brh2 or A. thaliana Brca2 results in meiotic recombination defects similar to those seen with Rad51 mutants (21, 41). To determine whether Cebrc-2 is required for DSBR and/or meiotic recombination, we isolated brc-2 (tm1086), a deletion that completely removes exons 5 to 7 and partially deletes exon 8 (Fig. 3A and B). Although the first four exons are intact in brc-2 (tm1086), Western blotting with a CeBRC-2 antibody raised against the N terminus of the protein failed to detect a truncated product of 138 amino acids that is predicted from the brc-2 (tm1086) deletion (Fig. 3C). Since no CeBRC-2 product could be detected in the mutant, we believe that the brc-2 (tm1086) deletion constitutes a null mutation. Consistent with an essential role in meiosis, Cebrc-2 mutants are egg laying defective (Egl) and fail to give rise to any viable progeny due to embryonic lethality (Emb) (Fig. 4A; see also Fig. S1B in the supplemental material). The cause of the Egl phenotype is not known, but a similar phenotype occurs following gamma irradiation of animals depleted of rad-51 by RNAi (38).
![]() View larger version (19K): [in a new window] |
FIG. 3. Cebrc-2 deletion mutant. (A) Schematics of the gene structure of Cebrc-2 (T07E3.5) and the predicted protein product for wild-type (Wt) N2 (394-residue protein) and the brc-2 (tm1086) deletion mutant (138-residue predicted protein). brc-2 (tm1086) carries a 672-bp deletion in the Cebrc-2 gene that removes exons 5 to 8. aa, amino acids. (B) Nested PCR with Cebrc-2-specific primers of wild-type N2 (lanes 1 and 4) and brc-2 (tm1086) heterozygotes (lanes 2 and 3) showing the 672-bp deletion. In lanes 2 and 3, the faint band above the tm1086 deletion product corresponds to the internal PCR product amplified from the wild-type chromosome. (C) Although a 138-residue protein could be expressed from the brc-2 (tm1086) allele, Western blotting with an N-terminus-specific CeBRC-2 antibody failed to detect any protein in a brc-2 (tm1086)/ mutant protein compared with full-length CeBRC-2 protein in wild-type N2. The asterisk indicates a nonspecific protein that cross-reacted with the CeBRC-2 antibody.
|
![]() View larger version (48K): [in a new window] |
FIG. 4. Embryonic lethality and meiotic DSBR defects in Cebrc-2 mutants. (A) Table of the number of viable progeny and the number of DAPI-stained structures observed at diakinesis in animals of the indicated genotype (n, number counted). The corresponding defect(s) in meiosis is indicated. N2 (wild type [Wt]) (1) and the lig-4 mutant (7) have a very low frequency of embryonic lethality and display six bivalent chromosomes at diakinesis. Cebrc-2 (2), rad-51 (3), Cebrc-2 rad-51 (4), and rad-51 lig-4 (9) mutants fail to produce any viable progeny and display between one and five DAPI-stained structures at diakinesis. Cebrc-2 lig-4 (8) and Cebrc-2 rad-51 lig-4 (10) mutants fail to produce any viable progeny and display nine or more DAPI-stained structures at diakinesis. (B) Germ lines from adult hermaphrodites of the indicated genotype were isolated, fixed in paraformaldehyde, and stained with DAPI. A representative projection of a three-dimensional data stack through a single oocyte nucleus at the diakinesis stage of the meiotic prophase is shown. N2 (wild type) (panel 1) and the lig-4 mutant (7) display six DAPI-stained bivalent chromosomes at diakinesis. Aggregation of chromosomes and chromatin decompaction are detected at diakinesis in Cebrc-2 (panel 2), rad-51 (3), Cebrc-2 rad-51 double (4), and lig-4 (RNAi) rad-51 double (9) mutants. Twelve DAPI-stained univalents are seen in spo-11 (panel 5) and spo-11 Cebrc-2 double (6) mutants. Twelve or more DAPI-stained structures are seen in lig-4 (RNAi) Cebrc-2 double (panel 8) and Cebrc-2 lig-4 (RNAi) rad-51 triple (10) mutants. Scale bar, 5 µm.
|
During wild-type meiosis, as nuclei exit the pachytene stage and proceed through the diplotene stage, chromosomes become progressively condensed, and by diakinesis, six distinct DAPI-stained bivalent chromosomes, each corresponding to a pair of homologs held together by a single chiasma, are readily detected in oocyte nuclei (Fig. 4A and B, panel 1). In contrast, Cebrc-2 mutants display chromosomal abnormalities at diakinesis (Fig. 4B, panel 2). To determine the nature of this defect in Cebrc-2 mutants, we measured embryonic lethality and analyzed chromosome morphology at diakinesis in other mutants known to be affected in meiotic recombination and DNA repair. We also generated double- and triple-mutant combinations with Cebrc-2 mutants to establish epistatic relationships with rad-51, spo-11, and lig-4. The results of our findings are summarized in Fig. 4A, and representative images of chromosomes at diakinesis in the various mutant combinations are shown in Fig. 4B.
In Cebrc-2 mutants, chromosomes at diakinesis are highly decondensed and aggregated (Fig. 4A and B, panel 2). Abnormal chromosome aggregates are detected in Cebrc-2 mutants that manifest fewer than six DAPI-stained structures, varying in number between one and five structures. The fact that we always observed fewer than the expected six DAPI-stained structures might reflect aberrant fusion events between chromosomes but could also correspond to other types of noncovalent entanglements. This phenotype is very similar to that previously observed in rad-51 mutants (Fig. 4A and B, panel 3), and Cebrc-2 rad-51 double mutants (Fig. 4A and B, panel 4) display a phenotype very similar to that of the single mutants alone, raising the possibility that these two genes function together in a common pathway (2, 38).
In spo-11 mutants, 12 DAPI-stained univalents are detected at diakinesis; these arise due to an inability to generate meiotic DSBs that would normally give rise to the chiasmata that physically tether homolog pairs to form bivalents (Fig. 4A and B, panel 5) (15). The absence of chiasmata in spo-11 mutants leads to a high level of embryonic lethality due to chromosome nondysjunction at the first meiotic division. However, chromosomes do correctly segregate at a low frequency in spo-11 mutants, resulting in a few viable progeny (Fig. 4A) (15). It was previously shown that rad-51 mutants are defective for the repair of SPO-11-induced meiotic DSBs (2). We therefore tested whether eliminating meiotic DSBs could suppress the meiotic defect observed in Cebrc-2 mutants. Indeed, spo-11 Cebrc-2 double mutants give rise to a low level of viable progeny and possess 12 univalents at diakinesis (Fig. 4A and B, panel 6). This result implies that the Cebrc-2 phenotype is caused by a defect in the repair of SPO-11-induced meiotic DSBs.
Cebrc-2 promotes an alternative DSBR pathway in the absence of HR and NHEJ. In mutants defective for HR, deletions and translocations arise due to the error-prone repair of DSBs by NHEJ or single-strand annealing (SSA) pathways (17). DSBR by NHEJ involves the direct religation of broken DNA ends and requires the Ku proteins, ligase IV, and a number of other factors. SSA, on the other hand, depends on resection of the DSB to reveal short stretches of homology that flank the break site. Pairing between these homologous sequences followed by ligation leads to deletion of the intervening sequence.
To determine whether the chromosome decompaction and aggregation events that occur in rad-51 and Cebrc-2 mutants are a result of repair of meiotic DSBs by NHEJ, we depleted lig-4 in Cebrc-2 and rad-51 mutants by RNAi. We also generated rad-51 lig-4 double mutants but were unable to generate lig-4 Cebrc-2 double mutants, as lig-4 and Cebrc-2 are tightly linked on chromosome III. lig-4 mutants or animals depleted of lig-4 by RNAi [lig-4 (RNAi)] are homozygous and viable and proceed through meiotic prophase normally, as shown by the presence of six bivalents at diakinesis (Fig. 4A and B, panel 7). RNAi depletion of lig-4 in Cebrc-2 mutants significantly reduces the occurrence of the chromosome aggregations that are seen in Cebrc-2 single mutants. The majority of Cebrc-2 lig-4 (RNAi) animals possess 12 structurally abnormal univalents at diakinesis, indicating the absence of chiasmata between homolog pairs and aberrant chromosome fusions (Fig. 4A and B, panel 8, and data not shown). In a few cases, we observed fewer than 12 DAPI-stained structures, and in others, we detected fragments of DNA leading to a total of more than 12 DAPI-stained structures at diakinesis (Fig. 4A). These observations suggest that NHEJ is at least partially responsible for the aberrant chromosome aggregates that occur in the absence of Cebrc-2. Surprisingly, in rad-51 lig-4 (RNAi) and rad-51 lig-4 double mutants, in which both HR (rad-51) and NHEJ (lig-4) are defective, chromosome aggregates still occur (Fig. 4A and B, panel 9). These results suggest that an alternative DSBR pathway is still operable in these mutants. Given the difference between Cebrc-2 lig-4 (RNAi) and rad-51 lig-4 mutants, we reasoned that Cebrc-2 may be required to promote the alternative DSBR pathway responsible for the chromosome fusions observed in the absence of HR (rad-51) and NHEJ (lig-4). To test this possibility, we depleted lig-4 in Cebrc-2 rad-51 mutants. Cebrc-2 rad-51 lig-4 (RNAi) mutants display mainly 12 nonfused but structurally abnormal univalents at diakinesis, similar to Cebrc-2 lig-4 (RNAi) mutants (Fig. 4B, panel 10). Thus, elimination of both lig-4 and Cebrc-2 is required to abolish the repair of meiotic DSBs that result in aberrant chromosome aggregates at diakinesis in rad-51 mutants.
Together, these data indicate that SPO-11-induced meiotic DSBs form normally in Cebrc-2 and rad-51 mutants but that, due to a defect in the HR pathway, meiotic DSBs are aberrantly repaired by NHEJ and an alternative DSBR pathway that requires Cebrc-2.
Aberrant RAD-51 localization and accumulation of RPA-1 at meiotic DSBs in Cebrc-2 mutants. To examine the basis of the HR defect in Cebrc-2 mutants, we performed germ line immunostaining with antibodies to RAD-51 and RPA-1 to monitor the recruitment and formation of RAD-51 and RPA-1 foci at meiotic DSBs. Since the meiotic prophase is spatially organized in a distal-to-proximal manner in the C. elegans germ line, we assessed the timing of the appearance and disappearance of these foci during the meiotic prophase by dividing the germ line into six zones and quantitating the number of foci per nucleus in each zone (Fig. 5A). In wild-type meiosis, RAD-51 foci appear in the transition zone (which contains nuclei in the leptotene and zygotene stages), become abundant from the late zygotene to the midpachytene stages, and are lost from the late pachytene stage onward (Fig. 5B, panels 1 and 6) (2, 12). These foci correspond to sites of meiotic DSBs as they are abolished in spo-11 mutants (2). In contrast to what is observed in the wild type, RAD-51 focus formation is dramatically reduced in the nuclei of Cebrc-2 mutants (Fig. 5B, panels 3 and 8) and is completely absent in rad-51 mutants (Fig. 5B, panels 2 and 7), Cebrc-2 rad-51 double mutants (Fig. 5B, panels 4 and 9), and Cebrc-2 spo-11 double mutants (Fig. 5B, panels 5 and 10). Instead, RAD-51 staining is both cytoplasmic and nuclear in Cebrc-2 mutants and Cebrc-2 spo-11 mutants (Fig. 5B, panels 3 and 5).
![]() View larger version (42K): [in a new window] |
FIG. 5. Loss of Cebrc-2 disrupts RAD-51 localization and results in RPA-1 accumulation at DSBs. (A) Low-magnification images of a wild-type germ line stained with DAPI depicting the six zones in which RAD-51, RPA-1, and apoptosis are quantitated. (B) Representative images of RAD-51 staining in midpachytene nuclei (panels 1 to 5) and quantitation of RAD-51 foci in the six zones of the germ line (6 to 10) for the indicated genotypes. Wt, wild type. (C) Representative images of RPA-1 staining in late-pachytene nuclei (panels 1 to 5) and quantitation of RPA-1 foci in the six zones of the germ line (6 to 10) for the indicated genotypes. (D) Increased apoptotic corpses in rad-51, Cebrc-2, and Cebrc-2 rad-51 double mutants. Corpses were counted in each of the six zones and are shown for the indicated genotypes as previously described (5).
|
Cebrc-2 is dispensable for sensing DNA damage and checkpoint activation. The defects observed in Cebrc-2 mutants may also reflect roles in sensing the presence of DNA damage or activating the DNA damage checkpoint (8). To test this possibility, we measured apoptosis of cells in the late pachytene stage and cell cycle arrest in the mitotic zone of the germ line, both of which require an intact checkpoint response (5). Although we observed profound differences between rad-51 and Cebrc-2 mutants in RPA-1 accumulation at meiotic DSBs, both mutants exhibited spo-11-dependent increases in apoptosis in the late pachytene stage compared to the wild type (Fig. 5D) (2). Moreover, Cebrc-2 rad-51 double mutants exhibited similar increases in apoptosis in the late pachytene stage compared to single mutants alone (Fig. 5D).
In response to treatment with hydroxyurea or gamma irradiation, mitotic nuclei at the distal end of the germ line of Cebrc-2 mutants undergo normal cell cycle arrest, whereas rad-5 checkpoint-defective mutants fail to arrest in response to both treatments (see Fig. S1D in the supplemental material) (1, 5). Together, these results imply that Cebrc-2 is dispensable for the intra-S-phase, G2-M phase, and pachytene checkpoints that induce cell cycle arrest and apoptosis.
Cebrc-2 is required for RAD-51 focus formation in response to DNA damage. In the wild type, germ line nuclei accumulate both RAD-51 and RPA-1 foci at sites of DSBs following treatment with gamma irradiation (Fig. 6A, panels 1 and 4, and 6B, panels 1 and 4). In contrast, RAD-51 focus formation is impaired in Cebrc-2 mutants after exposure to gamma irradiation, with increased levels of RAD-51 being seen in the cytoplasm (Fig. 6A, panels 3 and 4). In addition, the number of RPA-1 foci is increased compared with that in nonirradiated animals (Fig. 6B, panels 3 and 4). Since RPA-1 foci accumulate to approximately wild-type levels in rad-51 mutants following irradiation treatment (Fig. 6B, panels 2 and 4), we conclude that Cebrc-2 performs rad-51-independent functions in preventing the accumulation of RPA-1 at both meiotic and radiation-induced DSBs.
![]() View larger version (57K): [in a new window] |
FIG. 6. Radiation-induced defects in Cebrc-2 mutants. RAD-51 and RPA-1 staining reveal radiation-induced DSBR defects in Cebrc-2 mutants and following microinjection of dominant-negative BRC peptides into N2 (wild type [Wt]). Immunostaining was performed for RAD-51 (A) and RPA-1 (B) on germ lines of the indicated genotypes at 4 h after treatment with 75 Gy of gamma irradiation. The average number of RAD-51 and RPA-1 foci per nucleus is graphically represented (n, number of nuclei counted) The average number of foci per nucleus in the absence of gamma irradiation is shown by the white bars. (C) Schematic of wild-type (BRC_Wt) and mutant (BRC_Mut) BRC peptides. The mutant BRC peptide has a deletion of seven residues within the RAD-51 interaction domain. The BRC_Wt peptide efficiently pulls down RAD-51 from whole worm extracts, but the BRC_Mut peptide is defective for RAD-51 binding. Peptide pull-down assay samples and 1/10 the input (1/10I) were subjected to Western blotting with a RAD-51 antibody. (D) Representative images of RAD-51 staining in germ lines injected with BRC_Wt and BRC_Mut peptides. Each peptide (1 mg/ml) was microinjected into the germ line of 25 N2 (wild-type) animals. At 2 h after injection, animals were exposed to 75 Gy of gamma irradiation. At 4 h after irradiation, germ line nuclei were fixed and immunostained with RAD-51 antibody.
|
S36-R42) in the most highly conserved STAAGIR sequence that abolishes binding to RAD-51 (BRC_Mut) (Fig. 6C) (4, 14). Injection of the BRC_Wt peptide into the germ lines of wild-type (N2) worms blocks RAD-51 focus formation at sites of radiation-induced DNA damage in all germ lines injected (n = 25) (Fig. 6D). However, injection of the BRC_Mut peptide at up to five times the concentration of the wild-type peptide had no effect on RAD-51 focus formation at sites of DNA damage (n = 25) (Fig. 6D and data not shown). These results suggest that the BRC motif alone can function in a dominant-negative manner to block RAD-51 focus formation in vivo in wild-type animals. CeBRC-2 forms foci at radiation-induced DSBs independent of rad-51. We next performed CeBRC-2 immunostaining of wild-type (N2) germ lines to determine whether CeBRC-2 localizes to radiation-induced DSBs. In nonirradiated wild-type (N2) animals, CeBRC-2 is diffuse and detected at very low levels in nuclei (Fig. 7, panel 1). However, after radiation treatment, germ line nuclei accumulate a large number of discrete foci concordant with DNA (Fig. 7, panel 2). No signal is detected in Cebrc-2 mutants, demonstrating that the focus formation observed in wild-type animals after radiation treatment is specific to CeBRC-2 (Fig. 7, panel 3). These results imply that CeBRC-2 localizes to presumptive sites of DNA damage after radiation treatment.
![]() View larger version (64K): [in a new window] |
FIG. 7. CeBRC-2 forms foci after DNA damage independent of rad-51. Representative images show CeBRC-2 staining in mitotic germ line nuclei of the indicated genotypes before and 4 h after treatment with 75 Gy of gamma irradiation (IR). Wt, wild type.
|
|
|
|---|
CeBRC-2 regulates RAD-51 during HR. Our findings suggest roles for CeBRC-2 at two steps during the repair of meiotic and radiation-induced DSBs by HR: (i) it is required for efficient transport or retention of RAD-51 in the nucleus; and (ii) it is required for the targeting of RAD-51 to DSBs (Fig. 8). First, our observation that Cebrc-2 mutants have detectable RAD-51 in the cytoplasm by immunofluorescence analysis suggests that Cebrc-2 may be required for the efficient nuclear localization or nuclear retention of RAD-51. These possibilities will require further analysis to confirm but are consistent with previous findings that RAD51 accumulates in the cytoplasm of CAPAN-1 cells, which carry a truncating mutation in BRCA2 (14). C. elegans RAD-51 lacks an NLS; therefore, its entry into the nucleus may depend on an association with CeBRC-2, which possesses two NLSs flanking its OB fold domain. Second, previous studies with C. elegans demonstrated that RAD-51 foci form in the early meiotic prophase at sites of meiotic DSBs that are generated by the action of SPO-11 (2, 15). Since meiotic RAD-51 foci fail to form in brc-2 mutants, we propose that CeBRC-2 is required for recruiting RAD-51 to DSBs. Our observation that germ line injection of a BRC peptide acts in a dominant-negative manner to block RAD-51 focus formation in response to DNA damage suggests a role for CeBRC-2 in targeting RAD-51 to both meiotic and radiation-induced DSBs. Third, CeBRC-2 forms foci after radiation treatment, suggesting that it may localize to sites of active DNA repair in vivo. Together, these data support a role for CeBRC-2 in the recruitment of RAD-51 to processed DSBs in vivo (Fig. 8). Currently, we cannot exclude the possibility that the defect in RAD-51 focus formation in Cebrc-2 mutants may also reflect roles for CeBRC-2 in stimulating RAD-51 nucleoprotein filament formation, stabilizing the filament once it has formed and/or regulating the strand exchange activity of RAD-51 (3). Future studies with recombinant CeBRC-2 and RAD-51 in vitro may shed light on these possibilities.
![]() View larger version (24K): [in a new window] |
FIG. 8. Possible roles of CeBRC-2 in DSBR. (A) In wild-type (N2) animals, CeBRC-2 functions in DSBs through HR by transporting RAD-51 into the nucleus and targeting RAD-51 to processed DBSs. (B) In rad-51 mutants (defective for HR), CeBRC-2 may displace or prevent the accumulation of RPA-1 at resected DSBs. CeBRC-2 can also promote an alternative DSBR (aDSBR) pathway distinct from NHEJ. (C) In Cebrc-2 mutants (defective for HR and aDSBR), RPA-1 persists or accumulates at DSBs, and repair ensues by NHEJ.
|
Our data suggest two novel roles for Cebrc-2 independent of rad-51: (i) promoting an alternative DSBR process that is distinct from NHEJ and (ii) preventing the accumulation of RPA-1 at DSBs (Fig. 8). First, we have shown that chromosome aggregates detected at diakinesis in both rad-51 and Cebrc-2 mutants arise due to aberrant repair of meiotic DSBs. Chromosome aggregates still occur in rad-51 lig-4 double mutants (defective in HR and NHEJ), suggesting that an alternative DSBR pathway is still functional in these mutants. We show that the alternative DSBR pathway requires Cebrc-2, as revealed by the significant reduction in abnormal chromosome aggregates in Cebrc-2 lig-4 (RNAi) and Cebrc-2 rad-51 lig-4 (RNAi) mutants. We propose that Cebrc-2 normally functions in the HR pathway but can promote an alternative mechanism of DSBR when HR and NHEJ are compromised. One possibility is that CeBRC-2 is required for SSA. The budding yeast protein Rad52 is essential for HR and SSA and has many functional similarities with CeBRC-2 in DNA repair (25). Like CeBRC-2, Rad52 binds to ssDNA, interacts directly with Rad51, and is required for Rad51 focus formation at sites of DSBs (48). Rad52 also functions independently of Rad51 in DSBR by SSA, where it promotes homologous pairing between short stretches of ssDNA that flank the break site. Given the central importance of Rad52 in yeast DSBR, it is perhaps surprising that the genomes of C. elegans, Drosophila melanogaster, and A. thaliana lack a Rad52 homolog. It is therefore tempting to speculate that CeBRC-2 may have taken over the role of Rad52 in the SSA pathway. However, at this point we cannot exclude the possibility that CeBRC-2 may regulate a Rad52-like activity required for SSA or may function in an alternative DSBR pathway other than SSA. Although BRCA2-defective mammalian cells can perform SSA reactions (44), this function may be redundant with that of RAD52. In future studies, it will be important to define the precise role of CeBRC-2 in the alternative DSBR pathway.
Second, our analyses reveal that Cebrc-2 mutants accumulate RPA-1 at DSBs during the meiotic prophase and following exposure to gamma irradiation. Since this phenotype does not occur in wild-type animals and is suppressed by a mutation in spo-11, it is likely that this defect reflects recombination intermediates (resected DSBs decorated with RPA-1) that persist in the absence of efficient DNA repair via HR. However, this simple interpretation does not account for the fact that rad-51 mutants do not accumulate RPA-1 at DSBs yet are clearly impaired for meiotic and radiation-induced DSBR by HR. Our observation that radiation-induced CeBRC-2 foci still form in rad-51 mutants supports a model in which CeBRC-2 can perform actions at sites of DNA damage in the absence of rad-51 (Fig. 8). One possibility is that meiotic and radiation-induced DSBs become hyperresected in Cebrc-2 mutants, resulting in extended regions of ssDNA bound by RPA-1. Alternatively, CeBRC-2 may displace RPA-1 at processed breaks, an activity that can still occur in wild-type and rad-51 mutants. Consistent with these observations, Brca2-defective spermatocytes also exhibit significantly elevated levels of RPA staining (40). Furthermore, we have shown that CeBRC-2 binds preferentially to ssDNA in vitro and may therefore play a role in displacing RPA-1 at resected DSBs by competing for ssDNA binding (Fig. 8). Our observation that the CeBRC-2 fragment containing amino acids 114 to 394 and RPA-1 can weakly interact with each other in the yeast-two hybrid system (Fig. 2A) raises the possibility that CeBRC-2 may bind to and actively release RPA-1 from processed breaks. Unfortunately, it has not been possible to test whether CeBRC-2 can displace RPA from ssDNA in vitro, as only two of the three C. elegans RPA subunits are presently known.
CeBRC-2 is amenable to biochemical analysis. Investigation of the biochemical activities of human BRCA2 has been hampered by the inability to express and purify full-length protein to sufficient levels due to problems with its size, solubility, and nonspecific degradation. Full-length CeBRC-2 can be expressed and purified in large quantities (Fig. 2E and data not shown), an important development toward an in vitro system for elucidating BRCA2-related protein function during HR. Taken together with the fact that other HR cofactors exist in C. elegans, our findings suggest that future biochemical and structural studies of CeBRC-2 are likely to provide important insights into its role in repair and recombination.
In conclusion, C. elegans possesses a BRCA2-related protein that regulates RAD-51 during HR and promotes an alterative DSBR pathway in the absence of rad-51 and distinct from NHEJ. Given the functional similarities between CeBRC-2 and BRCA2, it is likely that further study of the C. elegans protein will provide mechanistic insight into the role of human BRCA2 in DSBR processes.
This work was funded by Cancer Research UK.
Supplemental material for this article may be found at http://mcb.asm.org/. ![]()
We dedicate this work to the memory of Nicole Winkelmann. ![]()
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2009 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»